Sh_004I20_p000010

Overview
NameSh_004I20_p000010
Unique NameSh_004I20_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length372
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004I20contigSh_004I20:21970..25415
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000620
InterProIPR030184
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004I20_t000010Sh_004I20_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004I20_p000010 ID=Sh_004I20_p000010|Name=Sh_004I20_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=372bp
MEEYKPCAAMVVTQCIYAALALWSKAVFTGGMSPLVFVVYRQAVATIVLV
PVVIAANRRKMKEMMGRLGITGFSLVFVASLVGATVNQCLYYQGVNLGSS
SMATAMTNLIPAITFVMAASVGLERVDVRRPRGLAKIFGTAVCVSGAMAM
AFFKGPKLLLGDLHALLLLHSPAAAGGRWVTGALFLVGSSSCWSLWLILQ
VPICKSYVDPLALSAWMCLLSTLQSALLVAFLLPDPSAWRIHSLFDLSCC
LFSGVFGSGVTFYLQSWSISVRGPLYSAMFNPLCTVITTVFAAAVLREEL
HVGSLLGAIAVIAGLYVVLWGKAGDAKMGPQEPEQHPDDLEKTSARSDSM
ADVGSGIAEPLLAGGDDPTEK*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Molecular Function
TermDefinition
GO:0022857transmembrane transporter activity