Sh_004I20_p000050

Overview
NameSh_004I20_p000050
Unique NameSh_004I20_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length185
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004I20contigSh_004I20:83303..83857
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004I20_t000050Sh_004I20_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004I20_p000050 ID=Sh_004I20_p000050|Name=Sh_004I20_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=185bp
MDPDLDPDVEPTTGADPDPEPDPDTDTPPVPAPTPRPRPSPRPSPCPSPP
PMPRFFLATRPCAARPQDSEHIKATSIRALAAAAAPLPPVILLDLQTITR
TRTLRAPASSPMRKASGVLLALYRSPSACGAKRNGTRRGRQLWPRDVPQS
ARDHVGVGERGWGAIMERWCVVLCQKGDELCWLG*
back to top