Sh_004L08_p000070

Overview
NameSh_004L08_p000070
Unique NameSh_004L08_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length234
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L08contigSh_004L08:89752..93411
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000711
InterProIPR026015
InterProIPR020781
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004L08_t000070Sh_004L08_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004L08_p000070 ID=Sh_004L08_p000070|Name=Sh_004L08_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=234bp
MAAARHLRSGLPLLRAHLASSESTAVAQVSRGFASQPPKPTGKEIKVPEA
LYGGTGNYASALFLTAAKVNSLDKVESEIKTVVEASKKSPLFSQFIKDLS
VPKETRVKAVTEIFADAGFSDVTKNFLAVLADNGRLKYIERIAERFVDLT
MAHKGEVKVVVRTVIPLPEKEEKELKDTLQDILGKNKTILVEQKIDYSIM
GGLVIEFGQKVFDMSIRTRAKQMEAFLRQPLEF*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0046933proton-transporting ATP synthase activity, rotational mechanism
Vocabulary: Biological Process
TermDefinition
GO:0015986ATP synthesis coupled proton transport
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane