Sh_004L14_contig-1_p000010

Overview
NameSh_004L14_contig-1_p000010
Unique NameSh_004L14_contig-1_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length125
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L14_contig-1contigSh_004L14_contig-1:5256..5630
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR016072
InterProIPR016897
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004L14_contig-1_t000010Sh_004L14_contig-1_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004L14_contig-1_p000010 ID=Sh_004L14_contig-1_p000010|Name=Sh_004L14_contig-1_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=125bp
MTAPTTASRSPTSTPRFSPRSSSTATSTSTAPPWTHTTNASGGGEDLKSW
DAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMMKGKTPEEIREI
FNIKNDFTKEEEDEIRRENQWAFE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process