Sh_004L14_contig-1_p000040

Overview
NameSh_004L14_contig-1_p000040
Unique NameSh_004L14_contig-1_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length534
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L14_contig-1contigSh_004L14_contig-1:77291..81440
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC5.5.1.18
InterProIPR023753
InterProIPR010108
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004L14_contig-1_t000040Sh_004L14_contig-1_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004L14_contig-1_p000040 ID=Sh_004L14_contig-1_p000040|Name=Sh_004L14_contig-1_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=534bp
MGLSGATISAPLGCRGLPRGAVGGGKARKAEAERWRRAGWSRRVGGPKVR
CVATEKHDEAAAVGVEFADEEDYRKGGGGELLYVQMQATKPMESQSKIAS
KLLPISDENTVLDLVIIGCGPAGLSLASESAKKGLTVGLIGPDLPFTNNY
GVWEDEFNDLGLESCIEHVWKDTIVYLDNNKPILIGRSYGRVHRDLLHEE
LLRRCYEAGVTYLNSKVDKIIESPDGHRVVCCDKGREIICRLAIVASGAA
SGRLLEYEVGGPRVCVQTAYGVEVEVENSPYDPSLMVFMDYRDCFKEEFS
HTEQENPTFLYAMPMSSTRVFFEETCLASKDAMSFDLLKKRLMYRLNMMG
VRILKVYEEEWSYIPVGGSLPNTDQKNLAFGAAASMVHPATGYSVVRSLS
EAPRYASVISEILRNRVPAEYLLGNSQNYSPSMLAWRTLWPQERKRQRSF
FLFGLALIIQLNNEGIQTFFEAFFRVPKWMWRGFLGSTLSSVDLILFSFY
MFAIAPNQLRMNLVRHLLSDPTGSTMIKTYLTL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016491oxidoreductase activity
GO:0016705oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO:0016117carotenoid biosynthetic process