Sh_004L14_contig-1_t000010

Overview
NameSh_004L14_contig-1_t000010
Unique NameSh_004L14_contig-1_t000010
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length375
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L14_contig-1contigSh_004L14_contig-1:5256..5630
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteSKP1-like protein 1B
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_004L14_contig-1_g000010Sh_004L14_contig-1_g000010R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_004L14_contig-1_p000010Sh_004L14_contig-1_p000010R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_004L14_contig-1_t000010 ID=Sh_004L14_contig-1_t000010|Name=Sh_004L14_contig-1_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=375bp
ATGACTGCGCCGACAACGGCATCCCGCTCCCCAACGTCAACTCCAAGATT
CTCGCCAAGGTCATCGAGTACTGCAACAAGCACGTCCACAGCACCGCCGT
GGACACACACCACCAATGCCTCCGGGGGCGGCGAGGACCTCAAGAGCTGG
GACGCGGAGTTCGTCAAGGTCGACCAGGCTACGCTCTTCGACCTCATCCT
GGCTGCCAACTATCTTAACATCAAGGGATTGCTGGACCTGACCTGCCAGA
CGGTGGCTGACATGATGAAGGGCAAGACTCCCGAGGAAATCCGCGAGATA
TTCAACATCAAGAACGACTTCACCAAAGAGGAGGAGGATGAGATCCGCAG
GGAGAACCAGTGGGCCTTCGAGTGA
back to top

protein sequence of Sh_004L14_contig-1_p000010

>Sh_004L14_contig-1_p000010 ID=Sh_004L14_contig-1_p000010|Name=Sh_004L14_contig-1_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=125bp
MTAPTTASRSPTSTPRFSPRSSSTATSTSTAPPWTHTTNASGGGEDLKSW
DAEFVKVDQATLFDLILAANYLNIKGLLDLTCQTVADMMKGKTPEEIREI
FNIKNDFTKEEEDEIRRENQWAFE*
back to top

mRNA from alignment at Sh_004L14_contig-1:5256..5630+

Legend: polypeptideCDSexon
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_004L14_contig-1_t000010 ID=Sh_004L14_contig-1_t000010|Name=Sh_004L14_contig-1_t000010|organism=R570 Sugarcane cultivar|type=mRNA|length=375bp|location=Sequence derived from alignment at Sh_004L14_contig-1:5256..5630+ (R570 Sugarcane cultivar)
ATGACTGCGCCGACAACGGCATCCCGCTCCCCAACGTCAACTCCAAGATT CTCGCCAAGGTCATCGAGTACTGCAACAAGCACGTCCACAGCACCGCCGT GGACACACACCACCAATGCCTCCGGGGGCGGCGAGGACCTCAAGAGCTGG GACGCGGAGTTCGTCAAGGTCGACCAGGCTACGCTCTTCGACCTCATCCT GGCTGCCAACTATCTTAACATCAAGGGATTGCTGGACCTGACCTGCCAGA CGGTGGCTGACATGATGAAGGGCAAGACTCCCGAGGAAATCCGCGAGATA TTCAACATCAAGAACGACTTCACCAAAGAGGAGGAGGATGAGATCCGCAG GGAGAACCAGTGGGCCTTCGAGTGA
back to top

Coding sequence (CDS) from alignment at Sh_004L14_contig-1:5256..5630+

>Sh_004L14_contig-1_t000010 ID=Sh_004L14_contig-1_t000010|Name=Sh_004L14_contig-1_t000010|organism=R570 Sugarcane cultivar|type=CDS|length=375bp|location=Sequence derived from alignment at Sh_004L14_contig-1:5256..5630+ (R570 Sugarcane cultivar)
ATGACTGCGCCGACAACGGCATCCCGCTCCCCAACGTCAACTCCAAGATT
CTCGCCAAGGTCATCGAGTACTGCAACAAGCACGTCCACAGCACCGCCGT
GGACACACACCACCAATGCCTCCGGGGGCGGCGAGGACCTCAAGAGCTGG
GACGCGGAGTTCGTCAAGGTCGACCAGGCTACGCTCTTCGACCTCATCCT
GGCTGCCAACTATCTTAACATCAAGGGATTGCTGGACCTGACCTGCCAGA
CGGTGGCTGACATGATGAAGGGCAAGACTCCCGAGGAAATCCGCGAGATA
TTCAACATCAAGAACGACTTCACCAAAGAGGAGGAGGATGAGATCCGCAG
GGAGAACCAGTGGGCCTTCGAGTGA
back to top