Sh_004L14_contig-1_t000080

Overview
NameSh_004L14_contig-1_t000080
Unique NameSh_004L14_contig-1_t000080
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length430
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L14_contig-1contigSh_004L14_contig-1:122039..122728
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_004L14_contig-1_g000080Sh_004L14_contig-1_g000080R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_004L14_contig-1_p000080Sh_004L14_contig-1_p000080R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_004L14_contig-1_t000080 ID=Sh_004L14_contig-1_t000080|Name=Sh_004L14_contig-1_t000080|organism=R570 Sugarcane cultivar|type=mRNA|length=430bp
GTACCATGTTCCTCGTTCATGGCTTAATCCGACAGGGAACCTTTTAGTTA
TATTTGAGGAGTGGGGTGGTGATCCTACTGGAATCTCGATGGTGAAAAGA
ACAACAGGGAGTATCTGTGCTGATGTCTCTGAATGGCAGCCATCAATGAC
AAACTGGCGTACAAAAGACTATGAGAAAGCCAAGATCCACCTCCAGTGTG
ATCATGGACGGAAGATAACTGACATAAAATTTGCCAGCTTTGGCACACCA
CAGGGCTCCTGCGGGAGCTATTCTGAAGGTGGTTGCCATGCACACAAGTC
ATACAACATATTTTGGAAGAACTGCATTGGTCAAGAGCACTGTGGGGTAA
GCGTGGTTCCAGGTGTATTTGGTGGGGATCCATGCCCTGGGACTATGAAA
AGAGCCGTTGTTGAGGCTATATGCGGTTGA
back to top

protein sequence of Sh_004L14_contig-1_p000080

>Sh_004L14_contig-1_p000080 ID=Sh_004L14_contig-1_p000080|Name=Sh_004L14_contig-1_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=143bp
YHVPRSWLNPTGNLLVIFEEWGGDPTGISMVKRTTGSICADVSEWQPSMT
NWRTKDYEKAKIHLQCDHGRKITDIKFASFGTPQGSCGSYSEGGCHAHKS
YNIFWKNCIGQEHCGVSVVPGVFGGDPCPGTMKRAVVEAICG*
back to top

mRNA from alignment at Sh_004L14_contig-1:122039..122728-

Legend: polypeptideexonCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_004L14_contig-1_t000080 ID=Sh_004L14_contig-1_t000080|Name=Sh_004L14_contig-1_t000080|organism=R570 Sugarcane cultivar|type=mRNA|length=690bp|location=Sequence derived from alignment at Sh_004L14_contig-1:122039..122728- (R570 Sugarcane cultivar)
AAGCTTCTGGAACCTGTGGAATCTGTGATTACCGTGGAGAGTATGATGAA AAGAAGTGCCAAACCAACTGTGGTGACTCTTCTCAGAGATGGTAGGCACT TCGTATACTTATGCAGAAATATCCTTGGAAAGTTTACATTTGGAGCTCTT TATATTCATGTCATGCTTGTTCAGGTACCATGTTCCTCGTTCATGGCTTA ATCCGACAGGGAACCTTTTAGTTATATTTGAGGAGTGGGGTGGTGATCCT ACTGGAATCTCGATGGTGAAAAGAACAACAGGGAGTATCTGTGCTGATGT CTCTGAATGGCAGCCATCAATGACAAACTGGCGTACAAAAGACTATGAGA AAGCCAAGATCCACCTCCAGTGTGATCATGGACGGAAGATAACTGACATA AAATTTGCCAGCTTTGGCACACCACAGGGCTCCTGCGGGAGCTATTCTGA AGGTGGTTGCCATGCACACAAGTCATACAACATATTTTGGAAGGTACAGG ATCTGCAAACTCTGGTCAAGTAAAGTGAAACTTTGAACTCGTATTTGTGT TTAGTAATTAAAATTGGCGTTTCTTACAGAACTGCATTGGTCAAGAGCAC TGTGGGGTAAGCGTGGTTCCAGGTGTATTTGGTGGGGATCCATGCCCTGG GACTATGAAAAGAGCCGTTGTTGAGGCTATATGCGGTTGA
back to top

Coding sequence (CDS) from alignment at Sh_004L14_contig-1:122039..122728-

>Sh_004L14_contig-1_t000080 ID=Sh_004L14_contig-1_t000080|Name=Sh_004L14_contig-1_t000080|organism=R570 Sugarcane cultivar|type=CDS|length=430bp|location=Sequence derived from alignment at Sh_004L14_contig-1:122039..122728- (R570 Sugarcane cultivar)
GTACCATGTTCCTCGTTCATGGCTTAATCCGACAGGGAACCTTTTAGTTA
TATTTGAGGAGTGGGGTGGTGATCCTACTGGAATCTCGATGGTGAAAAGA
ACAACAGGGAGTATCTGTGCTGATGTCTCTGAATGGCAGCCATCAATGAC
AAACTGGCGTACAAAAGACTATGAGAAAGCCAAGATCCACCTCCAGTGTG
ATCATGGACGGAAGATAACTGACATAAAATTTGCCAGCTTTGGCACACCA
CAGGGCTCCTGCGGGAGCTATTCTGAAGGTGGTTGCCATGCACACAAGTC
ATACAACATATTTTGGAAGAACTGCATTGGTCAAGAGCACTGTGGGGTAA
GCGTGGTTCCAGGTGTATTTGGTGGGGATCCATGCCCTGGGACTATGAAA
AGAGCCGTTGTTGAGGCTATATGCGGTTGA
back to top