Sh_004L16_p000020

Overview
NameSh_004L16_p000020
Unique NameSh_004L16_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length273
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L16contigSh_004L16:20564..22994
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR027417
InterProIPR003439
InterProIPR003593
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004L16_t000020Sh_004L16_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004L16_p000020 ID=Sh_004L16_p000020|Name=Sh_004L16_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=273bp
MLAAAATAVAVPPAASYRFPANTDRKCRISWSCRAARVEAAYSQLEVRKV
TYRPPGTEQNLLKEINLSLREKSFGLIFGRSGSGKTTLLQLLAGLSEPTS
GSICIQKYDDTGNPIGLPELLTSQRVGIVFQFPERYFLADTVLEEVTFEW
PRQKADLLLKEQLALNLQNAFNSVGLTTISLDEDPQALSGGFKRRLALAI
QLVQTPDLLLLDEPLAGLDWKARADVVNLLKDLKKHHTILVVSHDLRELY
PLVDYSWRMEMEGSLKEEALPV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005524ATP binding
GO:0016887ATPase activity