Sh_004L19_p000010

Overview
NameSh_004L19_p000010
Unique NameSh_004L19_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length376
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L19contigSh_004L19:819..7886
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR025887
InterProIPR030458
InterProIPR011013
InterProIPR000322
InterProIPR017853
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004L19_t000010Sh_004L19_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004L19_p000010 ID=Sh_004L19_p000010|Name=Sh_004L19_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=376bp
MNSVFTWNTDAWAYGPGTTSLYQSHPWVLAVLPDGKALGVLADTTLPCEI
DLRQESTIKFSVSSADPVITFGPLNTPAEVITSLSHAIGTVCMPPKWSLG
YHQCRYSYMSSEKVLKRERHSCDVIWMDIDYMDGFRCFTFDSNRFYNPKS
MVDDLHSIGCKAIWMLDPGIKNEEGYFVCESGSEMDVWVQKADGSPFIGK
VWPGDCVFPDFTSKRARAWWASLVRDFISNGVDGIWNDMNEPAVADTNTK
TMPESNIHRGDADIGGTQNHPYYHNVYVLFLCRGLAALSMQCSHNFLFHV
YGMLMARSTYEGMVLANASKRPFVLTRAGFIGSQRYAATWTGDNMSTWEH
LHMSLSMILQLVGELFVPCIQKVPP*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0030246carbohydrate binding
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
Vocabulary: Biological Process
TermDefinition
GO:0005975carbohydrate metabolic process