Sh_004L19_p000020

Overview
NameSh_004L19_p000020
Unique NameSh_004L19_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length125
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L19contigSh_004L19:10385..10759
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004L19_t000020Sh_004L19_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004L19_p000020 ID=Sh_004L19_p000020|Name=Sh_004L19_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=125bp
MPRLLQDEQDDARQPPPRLRKPPRAAALVASASATTNADRRHARERMAAA
GDTDMVWVRVLEEGVFRFDASEAARAAAGPSLSFADPRRREVPREGSDEP
AVLPTCEVVGAVQKVVLKVRGMHV*
back to top