Sh_004L19_p000040

Overview
NameSh_004L19_p000040
Unique NameSh_004L19_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length413
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L19contigSh_004L19:51645..52883
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002902
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004L19_t000040Sh_004L19_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004L19_p000040 ID=Sh_004L19_p000040|Name=Sh_004L19_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=413bp
MSLWAWRLGLGLLLSSLLPLPPLATGDSTYATVCGKTGKYKINSTYQDNV
QYVTNYLVNYPTFTAGTGFASTSYGAAPDVVYGLGLCRGDTPDNVTCYEC
LSTASEMAPLLCPHDKDATLFYDGCIMRISNQDFLGTMDNEPVVVLNETM
TKPAALVSSFDALVGRLMNKTAEHAAASSIPTKKMATGEAVFDTDAGDDQ
PTKVYSLVQCTPDLTPAGCSRCLEHVLGILARRTPGSLGERVAGVRCNLR
FQVYPFYVGEAMVVLEGLGSAAPSPAPMSSRPLPPPSPRTVTPPDVRIRA
LASGRAAGEGFQPAPASTPERRTRNVPTRARGRIEHNPAARGNPLLSSPD
LTRNPQRPPREWGDGLNATRPRAGIRSPHLQTFVMPPKQPSPPPHTATSS
PRKLHLAAPCRR*
back to top