Sh_004L19_t000060

Overview
NameSh_004L19_t000060
Unique NameSh_004L19_t000060
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length3321
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L19contigSh_004L19:62830..78053
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
NoteMyosin-6
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_004L19_g000060Sh_004L19_g000060R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_004L19_p000060Sh_004L19_p000060R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_004L19_t000060 ID=Sh_004L19_t000060|Name=Sh_004L19_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=3321bp
ATGGCATCCAAAGTCCGCTTTACAGTGGGTTCTCATGTTTGGGTTGAGGA
TGCTGAGGTGGCTTGGATTGATGGGCTGGTGGAGGAGGTCCAAGGAGATG
AATTAATTATAAACTGCACTTCTGGGAAGAAGGTTACTGCCAATGTCTCA
AGTGTGTATCCTAAGGATGCAGAAGCGAAGCGCTGTGGCGTTGAGGATAT
GACGAGGCTAGCTTATCTTAATGAACCAGGAGTTCTACAGAACTTAAAGT
CTAGATATGCAATGAATGAAATATATACTTATACTGGCAACATTTTAATA
GCTGTTAATCCATTTCAAAGACTTCCCCACCTTTATAACAATCACATGAT
GGGAATCTATAAAGGCGCAGAATTTGGCGAGCTGAGCCCTCATCCTTTTG
CCATTGCAGATCGTGCATATAGGCTTATGATGAATTATGGTAGAAGCCAA
GCCATATTAGTGAGTGGTGAAAGTGGAGCTGGTAAGACAGAAAGCACTAA
AAGTCTTATGCAGTATCTTGCATTTATGGGTGGCAAAGCTCAATCTGGGG
GAAGGTCAGTGCAGCAACAAGTACTGGAGTCCAATCCTGTTCTTGAGGCA
TTTGGAAATGCAAAAACAGTCAGGAATAATAATTCAAGTCGTTTTGGCAA
ATTTGTTGAGATTCAGTTTGACAAGAATGGGAAGATCTCAGGAGCTGCCA
TAAGGACTTACCTCCTAGAAAGATCTCGTGTCTGTCAAATATCTGATCCA
GAAAGGAACTATCACTGTTTTTACATGCTATGTGCTGCACCACCTGAGGA
CCGTGAGAGATATAAACTGGGAGATGCCGCATCATTTCACTATCTTAACC
AGTCTAGTTGCATTAAGCTTGATGGGATGGATGATGCTTCAGAATATATC
ATAACTAGGAGGGCAATGGACATTGTGGGCATCAGTTCTGATGAACAGGA
TGCAATATTTAGAGTTGTCGCTGCCATTCTTCATTTGGGCAATGTGGAAT
TTTCAGAAGGGAGTGAAGCAGATTCTTCTGTACCTAAAGATGACAAGTCC
CAGTTCCATCTTAGGACAGCTGCAGAGCTTTTCATGTGTGATGAGAAAGC
TCTTGAGGAATCTTTGTGTAAGCGAGTTCTGGTAACACGTGGTGAAAGTA
TTGTGAAAAATTTAGATGCACGAGCAGCAGCTCTCAGTAGAGATGCATTG
GCCAGAATTGTTTACTCTCGTTTGTTTGATTGGCTTGTAAATAAGATAAA
TACTTCAATAGGACAAGATCTAAGTTCAAAGCTTCTGATTGGTGTACTGG
ATATATATGGTTTTGAGAGTTTCAAGACAAACAGTTTCGAGCAGTTTTGC
ATCAACTTAACTAACGAGAAGCTGCAGCAACACTTTAATCAGCATGTGTT
TAAGATGGAACAAGAGGAATATACAAGGGAAGAAATTGATTGGAGTTATA
TCCAGTTCGTAGATAACCAAGAGATTCTTGATCTTATTGAGAAGAAACCA
GGGGGTATAATTGCTCTACTGGATGAAACTTGCATGTTGCGAAATTCAAC
CCATGAAATATTTGCTGAAAAGCTGTATCAAAAATTTAAGGGGAACCCAC
ATTTCAGTAGGCCAAAGTTCTCACGGTCTGATTTCACTATTCATCACTAC
GCTGGAAATGTTACGTATCAAACAGATCTGTTCTTGGATAAGAACATTGA
TTATGCTGTGAATGAGCATCAAGTTTTGTTACATGCTTCGAGATGTTCAT
TTGTTTCCAGTCTTTTTCCACCTTCTGAAGAATCAGCTAAATCTACGAAA
TTTACATCGATAGGTTCAAGCTTTAAGCAACAATTACAAGCTTTGCTGGA
AACTCTGAGTGCAACAGAGCCACATTACATCCGCTGCATAAAGCCCAATA
ATGTTCTCAAGCCAGCAATTTTTGAGAACAGTAATGTTCTCCAGCAACTT
CGATGTGGGGGAGTATTAGAGGCAATAAGAATAAGCTGTCTAGGATATCC
AACAAGGAGGAGATTTGACGAATTTGTTGACCGTTTTGGTGTTTTACTAC
CTGAAGTTCTTGGTGAAAGTTATGATGAAGTTACTGCTACAAACATGCTT
CTTGAGAAAGTCAATCTCACAGGCTATCAGATCGGGAAAACTAAATTGTT
TTTACGTGCTGGTCAAATGGCTGAATTAGATGCTCTGAGAACTGAGGTCT
TGGGCCGTTCTGCCAGTAAAATCCAGAGAAAAGTACGGTCATACTTGGCT
CGCAAAAATTTCATTCAACTGCGAATATCTGCTACTCAGCTCCAGGCTAT
TTGCAGAGGACAAATTGCAAGACATTATTACGAAGATCTCCGCAGGGAGG
CTGCTTCATTGACCATACAAACCTGCTATCGTATGCACTTTGCAAGGAAG
AACTACAGAAATCTCTGTACTGCATCAACTACTATCCAATCTGGTCTACG
TGGTATGGCTGCTCGCAAGGAACTCCAGTTCCGTCAGCAAACAAATGCTG
CAGTGATCATTCAGAGTTTCTGGCGTAGTTATGTAGCACGCTCTCGATTC
ATGAGCTTGAAGAAGGCAGCCATTGCTACCCAATGTGCTTGGAGAGGAAG
AGTGGCCAGAAAAGAGCTTCGGAAACTTAAAATGGCTGCTAAAGAAACTG
GTGCTCTCCAAGCTGCCAAGAATAAATTAGAGAAGCAAGTTGAGGAGCTC
ACCTGGCGGCTGCAACTAGAGAAACGCATGAGGACTGACATGGAAGAAGC
CAAGACACAAGAAAATCGGAAGTTGCAACAACAATTGCAGGAACTGCAAT
TGCAGTCCAAGGAGACCAAAGATCTGTTGAAAAGGGAACGGGAAATTGCA
AAAGAAGCGCTAGAGAAAGCTTCGTTAGTACCAGAGGTCCAAGTTGATAC
AACTCTTATTGATAAACTCACTGCTGAGAATGAGAATCTTAAGGCTTTAG
TGGGCTCTCTTGAGACCAAAATTGATGAAACAGAACATAAGTTTGAAGAA
ATGAAGAAAGCAAGGGAAGAGTGGCTGAAGAAAGCTACAGATGCCGAGTC
AAAGATAAATGAACTGACCAACACAATGCTAAGTTTTCAAGAAAAGGTAA
CTACTATGGAAGCAGAAAATCAACTACTTAGGCAGCAGGCACTGTTGCGT
ACTCCTGTTAGAACAATTCATGAAAACACATCTCCGAAATCTAATTTGAC
TAATGGCAGTCTACGCATTGATGAACAAAAGACACCTCATGGAACTCCTC
TTGCTCCCAAAGATTATGGGAGCTTTGGACAGCCTAGAGCATCCTTTTTT
GAGAGGCAGCATGTATGTTAA
back to top

protein sequence of Sh_004L19_p000060

>Sh_004L19_p000060 ID=Sh_004L19_p000060|Name=Sh_004L19_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=1107bp
MASKVRFTVGSHVWVEDAEVAWIDGLVEEVQGDELIINCTSGKKVTANVS
SVYPKDAEAKRCGVEDMTRLAYLNEPGVLQNLKSRYAMNEIYTYTGNILI
AVNPFQRLPHLYNNHMMGIYKGAEFGELSPHPFAIADRAYRLMMNYGRSQ
AILVSGESGAGKTESTKSLMQYLAFMGGKAQSGGRSVQQQVLESNPVLEA
FGNAKTVRNNNSSRFGKFVEIQFDKNGKISGAAIRTYLLERSRVCQISDP
ERNYHCFYMLCAAPPEDRERYKLGDAASFHYLNQSSCIKLDGMDDASEYI
ITRRAMDIVGISSDEQDAIFRVVAAILHLGNVEFSEGSEADSSVPKDDKS
QFHLRTAAELFMCDEKALEESLCKRVLVTRGESIVKNLDARAAALSRDAL
ARIVYSRLFDWLVNKINTSIGQDLSSKLLIGVLDIYGFESFKTNSFEQFC
INLTNEKLQQHFNQHVFKMEQEEYTREEIDWSYIQFVDNQEILDLIEKKP
GGIIALLDETCMLRNSTHEIFAEKLYQKFKGNPHFSRPKFSRSDFTIHHY
AGNVTYQTDLFLDKNIDYAVNEHQVLLHASRCSFVSSLFPPSEESAKSTK
FTSIGSSFKQQLQALLETLSATEPHYIRCIKPNNVLKPAIFENSNVLQQL
RCGGVLEAIRISCLGYPTRRRFDEFVDRFGVLLPEVLGESYDEVTATNML
LEKVNLTGYQIGKTKLFLRAGQMAELDALRTEVLGRSASKIQRKVRSYLA
RKNFIQLRISATQLQAICRGQIARHYYEDLRREAASLTIQTCYRMHFARK
NYRNLCTASTTIQSGLRGMAARKELQFRQQTNAAVIIQSFWRSYVARSRF
MSLKKAAIATQCAWRGRVARKELRKLKMAAKETGALQAAKNKLEKQVEEL
TWRLQLEKRMRTDMEEAKTQENRKLQQQLQELQLQSKETKDLLKREREIA
KEALEKASLVPEVQVDTTLIDKLTAENENLKALVGSLETKIDETEHKFEE
MKKAREEWLKKATDAESKINELTNTMLSFQEKVTTMEAENQLLRQQALLR
TPVRTIHENTSPKSNLTNGSLRIDEQKTPHGTPLAPKDYGSFGQPRASFF
ERQHVC*
back to top

mRNA from alignment at Sh_004L19:62830..78053+

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_004L19_t000060 ID=Sh_004L19_t000060|Name=Sh_004L19_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=15224bp|location=Sequence derived from alignment at Sh_004L19:62830..78053+ (R570 Sugarcane cultivar)
GAATCCAAATCTAGCGGCACGCTTCACGTCGCGATCCCGCGGACTCCACC CACCCCCGCGGCGGCAGCGCGGATCCCGCCGTGGGCTCGCGCGTCGGCCA CTCCGGCGCTAACTCCCCTCTCGCGGCGGCGGGAGGGCGGTAGCGGCGAT CGCGCTAGCGGAGCCGCTTCTTCGCCCTCGGCGCCGCCGGCCTTGATCCG GCCCCGCAGACGGAATGGTACGTGCTGTGATTTGCTTTTCGTCGGATTTA TCTGTGCTTGTTGTTATTTGTGCTTTGTTTGGGTAGTAGCGTGTTGGGGA TTGCCCCGCTTGATGAAGGCGTCGAAATGCCGGCTCGGTTCGGGGTGTTT CCACGCCGTTTGGTGTAATCGTTTAGCTGAAGCAGTTGTGTATGGTGCGA TCATTGACATTGAGATAAACACGTCTTATTGAACCGGGCATAATTTCGGG AAATGGTGTACCTAGGATATGAATCGAGGCAGCCTTTTGTTGTCCTTCCT TCTTCTGGCCGTGACTGTGCAATGTGGTGAGGTTGGGGTCTCTGCCTCAG CCCCTCATACCGTCTTATGGTAGATTCCATCTTGTTCTTCTCACTGAGAC ACTCGGATCATCTCATGGAACTTGATCAAGGTTTTTGTGATACTGCTGGG CTAGCATTAATCAAGAATAATTAGGATCTTTATTCTCTGTTTGGTTCATT AGTTCTTCAATGAGTGTGCAAAAATGGGCACCTAAATCATGGGACAATGT CTATGGATGCTTACTTCTTTTCACACTTAGTGTTTAAATGTGGGCAAGAA CTTAGGTTATGTGTCCTGTTATCACCAGATGTGGATCCTCATATGCCAGT TGTAAGTTCAAACACAATGGAATGATATGATATTCAAGAACTTCTCAACT ATTATTTTGTCAATAAATGTGTCTCCTCATTGTAATTTTGGATTGAGATA TTGTAGTTGTTACTATTCTTTCTTCACTCATCGTCCTTCGTACTTGTTAG TTTACTGTAATGACTGGTTAACTGACATTAGTCGTGTTCTTGTGCATTCT GTTGCAGGCATCCAAAGTCCGCTTTACAGTGGGTTCTCATGTTTGGGTTG AGGATGCTGAGGTGGCTTGGATTGATGGGCTGGTGGAGGAGGTCCAAGGA GATGAATTAATTATAAACTGCACTTCTGGGAAGAAGGTCAGTTATTAGTT CCATGATAGGTTTCTCTTTTTATTTTCTGCCAAAAGTGAGATTTTGTTAG TTTATCTCGTCCTGATGGTTTGTTACTTTCTATTCATGCTTTACTGAGGC TGTTGCAGCACGTTTCTCCTAAAATTCTTTTTTATGCCTCAGGTTAATTG TTTTTAAGTCTGAATTTGTTAATTCATGAGTGTCAGACTATACCGCTATA GCTTATAATAGTAAATTAATTTATTAAAGTATATGGATAATGATAAATAA AAATAAATAAACATATTTTGGTTACAGGTTACTGCCAATGTCTCAAGTGT GTATCCTAAGGATGCAGAAGCGAAGCGCTGTGGCGTTGAGGATATGACGA GGCTAGCTTATCTTAATGAACCAGGAGTTCTACAGAACTTAAAGTCTAGA TATGCAATGAATGAAATATATGTAAGTTGAGTTGTTCAACATATCAACAC TTCTTTTATTCTTTTTACTCATGCATAGTCCGGCGAGTTCTTGGTTATCT GACTTTTCAGTTCTTATTTGCTCTCTAGGATGATAGTAGAGTTACTCATT CAAATTACACCTCCTGTGTCCTGTCTGTATAGTGTTTATGTTTCATTGCT ATTCTTATTTTATTGGTGTTAAGGTGTTTACTGTTTCTAGTTTCTGTATC AGAGGAGGTTGGAATTCTGCAACACTGCATCTGTTTTTATTTTATAACAT GCTCTAGTGTACCGAACAACCTTGTGGTCTGATCTAACCGCTTAAAGATG TTTGTCCTTTCCAGACTTATACTGGCAACATTTTAATAGCTGTTAATCCA TTTCAAAGACTTCCCCACCTTTATAACAATCACATGATGGGAATCTATAA AGGCGCAGAATTTGGCGAGCTGAGCCCTCATCCTTTTGCCATTGCAGATC GTGCATATAGGTGTGTTTCAACCCCCCAAGGAAAACTAATGTTTTATGCA TTTATCGTGTTGCATGTATCTGACATATAAACCATGCAGGCTTATGATGA ATTATGGTAGAAGCCAAGCCATATTAGTGAGTGGTGAAAGTGGAGCTGGT AAGACAGAAAGCACTAAAAGTCTTATGCAGTATCTTGCATTTATGGGTGG CAAAGCTCAATCTGGGGGAAGGTCAGTGCAGCAACAAGTACTGGAGGTGA GGGCTCCAATTTCTCTTCTTGCTCTTGTGAATATTAGCAACCCAAAATAG TGGATTTATGGATTATGAACTGGCATCTTGGAATGTTTGTAAAGGAGCAA GCTGATCGTTCTGCAGGATTGCATCAAACTCACATTTTACCAATCTTAAT GCTATTGTGTCTTATACTATCTAATCTATCTATTTGATTGACGCAGTCCA ATCCTGTTCTTGAGGCATTTGGAAATGCAAAAACAGTCAGGAATAATAAT TCAAGGTAATGAACTTAAAAAACATGGTTATTATTTTCTTTTTTCTGTTT CTGACAGTTGGCATTTGCTCGTTAGCACAATCTTTTCTATTTTTTCCTCA TACTTTGTCGCTTTCTTTTATCTTATTATGCAGTCGTTTTGGCAAATTTG TTGAGATTCAGTTTGACAAGAATGGGAAGATCTCAGGAGCTGCCATAAGG ACTTACCTCCTAGAAAGATCTCGTGTCTGTCAAATATCTGATCCAGAAAG GAACTATCACTGTTTTTACATGCTATGTGCTGCACCACCTGAGGTAAAAA TTTCAACATGGCTACAAACCAAATTCTAAACTACAACTTTGTAAACAATA TATGGCAACTGTGTTGTCAGCCTACTATATTTTAGTACTACTTTTTTTTT TGATGATGTAGATTTTGCCATCAACTGTGTCTTCAACTTTTGATCTGTGT TAAAATGTTGCTGTGCAGGACCGTGAGAGATATAAACTGGGAGATGCCGC ATCATTTCACTATCTTAACCAGTCTAGTTGCATTAAGCTTGATGGGATGG ATGATGCTTCAGAATATATCATAACTAGGAGGGCAATGGACATTGTGGGC ATCAGTTCTGATGAACAGGTATATACATGTGTACGGTTGAAATTAATTTA TTTTATCTGAAGATAAAACATTTGCTTATAACTTCTGTTGCCATTTCGTG CAGGATGCAATATTTAGAGTTGTCGCTGCCATTCTTCATTTGGGCAATGT GGAATTTTCAGAAGGGAGTGAAGCAGATTCTTCTGTACCTAAAGATGACA AGTCCCAGTTCCATCTTAGGACAGCTGCAGAGCTTTTCATGTATTAGTCC TTTCTTGTGCTCCTTCCGTAATATTAGCTTGTTATCTTTTGCATGACATG CATTTGACAACATTTCAGGTGTGATGAGAAAGCTCTTGAGGAATCTTTGT GTAAGCGAGTTCTGGTAACACGTGGTGAAAGTATTGTGAAAAATTTAGAT GCACGAGCAGCAGCTCTCAGTAGAGATGCATTGGCCAGAATTGTTTACTC TCGTTTGTTTGATTGGTAAGTTCTCACATTGTCAAGCAGTTTATTATTGT TGCTTTATAGTATGTTACTTCTGTAACATAAAATGATAATTCACTTATGT TGCTGTTTTTTTCAGGCTTGTAAATAAGATAAATACTTCAATAGGACAAG ATCTAAGTTCAAAGCTTCTGATTGGTGTACTGGATATATATGGTTTTGAG AGTTTCAAGACAAACAGGTGCTTAACTGGTATGCCTTTGCGTTTAATCTT CTGTTTATCTTTATCAATGTCTTAATATAGTGTAATAAAGTCACAGCAGC AGTTTTTTTACTGGATAGTATTGGTGACATCGTAATAGTTGTGTTTTTTG ATGGGGCTGCTCCAAACTTAGCTGGTGCTTTGGGTTCTGCTTTGGAGGAG TGTCGGCTGTGGGCTTTGGCTGGGGCTCGGGGGCTATCTTTCTTGGCACC CCCACCCCCACCCCTCCCCCCCCCCTAAGGCTTTTTTCTATTTCTGGTCA CCTTTTTGTTCTCACAGGCGCGTGTGTAAGTCTTTGTAATTGGGAATGGT GTGGTGTGTGTTGTACGGGGTTTCTTCCCCTTTTTTCTTCTTAATATAAT GAAGCACAGTTCTCCTGCGTTTTCGAGAAAAAAAAGTGTTGGTGACATGA CGGGTTCAACATGTTCAAACTATGTTTGCTGCAATACAAAGCCATTCCAT CTATTTTGAAGTTAATTAAATCAAATGGCTTGTATTAGGATTATTTGTTT CATCACACATCTCAAGTCTTTGGAATTAGTTCAAAATGGAAATTGTCGAT TATATAACATATAGGTCATACAATGCCAGTTAAAACAATGGCCTTCATGT GCTTAGAAGTTAGAACGTAAACATATTTTTTCTGCTTTTTAACTAAAAGC GTAGTAGTATCAGCATATCTTAGGAGCTTTTCTCCTAATCTACTTTTTTT TGGAGTGGCTCTTTGGTGTCGCAACATTTTTAGGGAACTCCAAATAGATG AATAAAAAGCAGAGTGCATATTATGACAATCATTCAATATGCATGTTGAT TTCATTTTTTATATAGCAATAGGCTTTGTCAGGGGAAAAGATCCTCCATG TTGCTTTAAAAAGATTCATCGCTTAAGTTGCTCTTTTGTAAAGCGGAAAA AATAGCTTATTTGACCAAAGAAGGAGTAATTCATATGTGTGACTACAGGC CCAAAACATGCTAAATCAAATTCACATATTGAAAGAGTGGTAATTGTGAA GATTCAAAAGAATAAAAGGGATATGTAGCTATGGTCTTGACTCACAACAC TTGCTGCACAAAAGAAAACCTTAAGGGAAACCAACATCATGTTGTTGTTG ACATGAATGGGGACTCTGGTTTCAAAATTTGGCTGAAATATGTGCTCTTC TTTTTAGAGGTTGCAGCATGTAGTTTCTGCAGCTAATGGCTGCACTGGTT ATGGTGATGCATAGTAATAGCAAAGTTATATACTCTCCTTATTAAGAGCC TTAAGTCTTCCATAACTCTACTTAGCGAATGTTGTGTATGACATGAAACC ATCTTGTTATCTTTTGATGATACGAAACATAACAACTGTTATATGGTGAT ACTATGACATGCCTCAGTTTCGAGCAGTTTTGCATCAACTTAACTAACGA GAAGCTGCAGCAACACTTTAATCAGGTTAGAGAATGAAAGTCTCAGTTCT TGAGAATGTTCTGCATTCTATGTTTTAGCATCGTCAAATAAAATTTGTTT TGTGTCATTATGTGTAATCATTTTTTTTATATGTTCCATGAGCAGCATGT GTTTAAGATGGAACAAGAGGAATATACAAGGGAAGAAATTGATTGGAGTT ATATCCAGTTCGTAGATAACCAAGAGATTCTTGATCTTATTGAGAAGGTG AACAACATACAGTGTTCTTTGTAATGCTTTCTTTTATTATGTATATATTT ATTTTCTGCATTGGTATGATCGTTTTTGCACCAGTGTGAATCTGTGACAT TTTCTTTGACCTGCCTTCAGCTAGTTATTGCCTTTTTTAATTACTATTGT AGACTCATGTAACCTAGGATTCAATGTGGAATTATCTGATACCAATAATT ATTGAAGAAACTGGACGGGTCTGAGTTCAATGTGCAATTTTTTTTAACCA TCTAGAGATGTTAGTTAAAAATTTCCATTGTAGTTTGGCTATACTGTGAG ATTGCATTTTTGACATCTTTCTTTCAATACAGAAACCAGGGGGTATAATT GCTCTACTGGATGAAACTTGGTAAGTAAACCGTGAATATCTTGTTTGTAA TTCTGAGCCTTTCTAACATTGTCTTGTTTTGTGCTTCAGCATGTTGCGAA ATTCAACCCATGAAATATTTGCTGAAAAGCTGTATCAAAAATTTAAGGGG AACCCACATTTCAGTAGGCCAAAGTTCTCACGGTCTGATTTCACTATTCA TCACTACGCTGGAAATGTAAGCAGCATACTTGTTCTGTCTGCCCTACTAT CCTTTGAAAGAATAATTTTTACATTCTTCACGAAATGTAAGATGCATTCA TTGTGGACTTTGTGACAGTGTCACATATGATTGCGTACATTATATTAGAT TGTATTCTCTGTTCCAAATTATAGGTCACTTCAGCTTTGCCCTAAGTCAA ATTTCTCTAAATTTGACCAAGTTTGTAGAAAAATATATTAACACCTACAA GTTCAAATAAACAAACTATCAAGACATTTTTTTCCTCGAACACACAGGAG AGCTGCATATCATTATTAAATAAGAAGGATAAAAGGGTAAACAACCCCTG GTTACACCAACACCCACACACCCAAAGGATCGCAACATTACATACTCCCT CCGTCCCAAAAAAAGAGTCATTCTCGCTTCCCAAAAAGTCAACAACTTTT AACTTTGACCAAATATATTTAACAAAATATTAATATTTATGGTACATAAT TAGTATCATTAGGTAGATCTTTGAATATACTTTCATAATAAACTTATTTA AAGACATAAATGTTGCACGCATTTTCTACAAACGTAGTCAAAGTTGAGAA AGTTTGACCAGCACGCTTCCCACGGCGACTCTTTTTATGGGACGGAGTAG TATGTGTCTTTTTGCTATAAGTACACAAGACCTGGAACGACCTAGCCCCT AGGAACAAGGTCCGACAAGAAAGAGATCCCTCGCGCTCCAGCCAATGCCC AAAGTTGGGTCTCCTCCTCACATTTGTTCCTATGTTTCCAAAGTGTCGAA GCCTCTAGGATAATGAGGGAGTTGATGCTTCGTTGCAATTGTCCATCGAT CATCTCATCAGCTCTATACCACTAGTCCTCAAAAGAAGCATCATTGATCA TCAGTGCTAGAGTTTTGCAGCCCAAAGCAATTTAGGAGGGAGAACCAGAA TTGCCTTGCAAACATACAGCTAGTGAGCAAGTGATCAATTGTTTCCTCAG CTTGGCGTTCTTATACATCTGTATTTTCTTTTTCTTTTTCACATAGTGCA CAACTGCACATATGGAGATATTTTTGCAGATACATGTTTTGTAATGTAAA TGCACTGAATTTTTGAGGTATACTAGTGCATAAACCCAACTTACATGTAG ATAAAGGATGTAAGTTTAGAATAATTCCCCTTTTCTAACACTTCAATAAG CAACTTTTCAGCTTATGCTTTGTTCCTGTCGCTGGCAACAAAATCACTTA CTGCACATGATGCATACATTTAACCTGGAGATGAATTAGTTCTGTGGTGC CATCATATCTTTCTATAATTGAACAGAGTATCTGAGTATGTGGCACAATA TTAAACACCATTTTCTTATGCAGGTTACGTATCAAACAGATCTGTTCTTG GATAAGAACATTGATTATGCTGTGAATGAGCATCAAGTTTTGTTACATGC TTCGAGATGTTCATTTGTTTCCAGTCTTTTTCCACCTTCTGAAGAATCAG CTAAATCTACGAAATTTACATCGATAGGTTCAAGCTTTAAGGTAAAACAG AATGTTGCTTGTCCAGTCTTTTATAGCTTTGTTATCAGGAAACTTATCGT TTCTGATAACATTACAGCAACAATTACAAGCTTTGCTGGAAACTCTGAGT GCAACAGAGCCACATTACATCCGCTGCATAAAGCCCAATAATGTTCTCAA GCCAGCAATTTTTGAGAACAGTAATGTTCTCCAGCAACTTCGATGTGGGG TAAGACATTCTCACAAGTATTTTCACTGGAAGTACATGTTTTGACAGATA TAGAATGGTTGAATAGAAAAATAAGGACAAGCTTATTCTGGTAAATCAAA ATTATTTTGAACCATCTGCCATTCTTCCCTATTTAACCATATATGGAGGC TGCTAAACGTTTATTCATTTGAACTGATCTAAGGACAAAAGACAATCATG TGGACAAAACAGTATACAGCATACAGGTACTACTGTCCCAAAAAGAATGC ACATTAGATTTGTCAAAGTCAAACTATTTCAAGTTTGACTAAATTTATAG AAAGTAATGTCAGCAATCATGGTTCCAAATAGGTATACTATAAAAATACA TTCCATGATGAATCTAATGACATTATTTGATATAATAAATATTACTATTT TTTTGTAAAAAATTGGTCAAATGAAGATGGTCTTGACCTAGTGCTGTAGC TAGAAGTGCACTCTTTCTGGGACTGAGGGGTGTTTCTGCAGTACACATGA TAGCGGTATGCCCAGGGATTTTTATGCTTTTAAATCTTGCTCTTAGTGCA GTTTGTTTTTGTATGAACTAGCTGTTGAAAATAGAGATGCTAAACTGATA CATTATCTAATCTTGTAAACAGGGAGTATTAGAGGCAATAAGAATAAGCT GTCTAGGATATCCAACAAGGAGGAGATTTGACGAATTTGTTGACCGTTTT GGTGTTTTACTACCTGAAGTTCTTGGTGAAAGGTATTCTTAATACATCGA TCTGGTCTTTTGCATTTTGGTTTCCATTTTGATCTTACATTGTGTACTTA CTGTTACATTGGCAGTTATGATGAAGTTACTGCTACAAACATGCTTCTTG AGAAAGTCAATCTCACAGGCTATCAGGTCAGCTACAAGTGGCTGAAATTA GTAGTTTTGATGTGCTTAAGTCAATCAAATTTTCCACTAGTACTATGTTT GGTCTTTCTTTGGCTTCTCTACTGTTTCCCTTTATCGTGATTCAACATAT TTCCTGTATTCTCGTAATCTTGTAAATACTAAGGTCCTGTTGGAATGGGA TTTTTTTTTTCTTCTTGTTCCTGTGTTTTCCCTGCGAAATTAAACTGATT CATGTGAAATCCTTCATGATTCCTGTAAAATTCCTGTGTTCCAAACAGCT AAGCATTTCTAGTTGAATGATATATACTTTCTTGCCTCAGCCTTTATGTT GCTCCCAGAAAAATCCCATGTGGAGATTAGTTCTACTTTAGTTTTATGGT TCGATGGCTTAGGAGATTGGGTCAATTTCAACCCAAACAATGGACATGTT ATCTTGTTGTCATGAGAAGAATATTTGCAATTCCTCAAAAATAAAGTCGA GAACAACCTTGTATATATTTTGTCGTTGCATCATGGGAATTGTTAATAAG AGAAACATTAAGTGCAATGCAATATCTCCATCCTCATCTGGACAAGTTGC TGCTTCTGTAGTTCTAGCTTTAATATGCTAATTTGAATTACTCTTTGTAA TTTACAGATCGGGAAAACTAAATTGTTTTTACGTGCTGGTCAAATGGCTG AATTAGATGCTCTGAGAACTGAGGTCTTGGGCCGTTCTGCCAGTAAAATC CAGAGAAAAGTACGGTCATACTTGGCTCGCAAAAATTTCATTCAACTGCG AATATCTGCTACTCAGCTCCAGGCTATTTGCAGAGGTACATCTTAAATAG TACTGAAGATAAAAAAAAAAAGGTTTTAGTAATATCTCTGATTTTGAAGT GGAGATAATGATTGTTGAACTGTGATATTTGAAGGACAAATTGCAAGACA TTATTACGAAGATCTCCGCAGGGAGGCTGCTTCATTGACCATACAAACCT GCTATCGTATGCACTTTGCAAGGAAGAACTACAGAAATCTCTGTACTGCA TCAACTACTATCCAATCTGGTCTACGTGGTATGGCTGCTCGCAAGGAACT CCAGTTCCGTCAGCAAACAAATGCTGCAGTGATCATTCAGGTATGATCTC AGGTCTCCTTTTTAGTTTCTTTAAATTAAAAGCATCTAATTTTCAGTCAT CCATTCAAAGTCTTATCTTTTTGTGTATAAATAAATGGTTTGGATCATGC TACTAGGGCAGTCAAACTATGGTTATGTTTGCTTATCTTTTCATATCCAT ATTCAATTATTGACTAAAGTCTATCATGTTTACCTAGGGATTGTTATATC TTTTTCTGCACCTCCAGTTCCTGAATAAGTTTGTATTTACACTTATTATG ATTATAATTTTAAGTACATGTTTTATTACTTGCCTCTGTGCCACAAAGAA ATTACCAAGTTAAGAATTCCAGATGACTTTCTTTTTAATCTCAAGTAGCT TTATTTCTTCAAGTATCATTATTCAATTAGACGCCTGTTCAAGCCTGTGC ATCTGTATCCATATTTTACTAATCACTCTTTTACTTCATTTATGGTCCAA TACATCAACCTCGCTTTTACTCATTTGTCCTCCACAGAGTTTCTGGCGTA GTTATGTAGCACGCTCTCGATTCATGAGCTTGAAGAAGGCAGCCATTGCT ACCCAATGTGCTTGGAGAGGAAGAGTGGCCAGAAAAGAGCTTCGGAAACT TAAAATGGTAAGAAGCTCTGTTGTAAATGGCCTGACTATATTTTACTTTA TTAGTTATTGGCGTGCTTCTGCAGTATTTATTTTATTCCAATGTCTATGC ATAAGAGATGTCTGATGAATATGAATTATCAAAAAAGGTGTACACATCAT TACGTTGTCGATTGACAACTGGGTATATATGCACATGAAAATGAGGCTAT GTCTTCATGGGCCAAACTCGATTTATAGGCCAACTCCTTATGGAGTTATG GTCAGCAAAAGCTTATGGTCCTTATGGGCCAACTCATCTGCAATTGCACC TAATGGTCATAAGTCTAGCCATTACACTTCTGGTACTCTGGAGCCTGGAT CAACAATGGGAACTGAGTTATTACGTAAACTAATCATTGTTTAAGCTACA TTATCTACTAACTTCACCTTTCTTTTTTGTATTTTCAGGCTGCTAAAGAA ACTGGTGCTCTCCAAGCTGCCAAGAATAAATTAGAGAAGCAAGTTGAGGA GCTCACCTGGCGGCTGCAACTAGAGAAACGCATGAGGGTAAAGTTTTGGT TTACTTTATTTGACAGATGCTCTGGCTTTCTGTATTCGCATGGAAGGGAC ATTAAAAAAAATTGACCAACCAAGGACACTCCACCCCTGCTGACCACACA ACATATGTAGTATGACCTATAGACTCAACTTTTCTGAATGGGTCCAAAAA TATGCAGTCGCTAGAGCACATGCATGCACTTAAGTGGGTTTTTGCAAACT GTGGTTATCTTATTTTTTTTTATTTATCATTCTATTGTATACAGTTAGCT TCTAGAGCCAACTAGTTCTTTTCCAGTTCCAGCCAGTTTGAAGTTGATTG TTATCTAAGGATGCAAGTGGATTAGATTGGATTGGCTTGATCCAATTGTC TCATACTAGCCCATTTTGTTTACTGAATATATAAACAATGTATCATATGA GTTAGGAAGTGCACGGTATTTAATGGAGATGGTCGATTATCTTACATGCC TATTGTAATTGTTCACTGCAAATTAGCTATCTATTGTCTGAATTTCAGTA TTACTACTACAATATTGTAGTAACTCCCAGTTTTGTGGTAAACTTTATCC ATTTAAGTAAGGTTAATTTAAAGCAGATATGTAACTTTGTAACATGGACT GTAACTGTTGGCACAACCTAGGTCAATAAGGGCCTGTTTGGTTCACCACT AAGGAGAGCCTGGCTGGTATCTACCAGCCAGACTGCACAGGGACAGGCCA AAGGCATGCAACCACTTGTTTGGTTCACTGAATCTAGAAGATCAGGCTGA GCAGAGCACTTGTTTGGTTGGCTGCATCGATATAGGTTATATTGCGTTTT GAATCGATTGTATAGTACTCCCTCTGTTCCAAATTGTAAGTCGTGCTGGC TTTTCTAGATACATAGGTTTTGCCATGCACCTAGATATACATTATGTCTA GATGCATAGTAAAAGCCATGTACCTAGAAAAGCCAGAATGACTTACAATT TGGAATGGAGGGAGTACTTATTTTCAACATATTAAGCCATAATTAACTTT GAAATACATTAATATGCCTTAAATTATGCTAATTCATTAGTAACCTGCTA ATACATTGCATCCCGCGAGCCTAGCCCTGGAGAAATGGGTCTCATTCTCG TTCCTGGAGAGCCAGGCTCGCTGGTCCCTTCTGCACGCCGCAGGACAGGC CCAAACCATCGCCCAAGCAACCAAACACAGTGCACCTGTGTCCATGGAGC CTGGCTGGTGTCACAGACAGACCCAATGCCAGAGGCTCCCACACGAGTGG GGTCTGGCGAAGGGAATAATCGAAGCAAAGTCTTACCCCCACAGAAATTC TGCAGAGAGACGGCTTCGAACCCAGGACCTAGTGACTCGGCGAGCTAGCA CTCACCAACTGCACCACCAGGCCTGCCCTTGGAGCCTGGCTGGTGTAGAT ACAGGAAACCAAACATGGCCTAAAAACATTCATATTAGCTCTAGTCATCT AATGCCTCTGTAAGCACCTTATGTACGTTTTCCCTGCCTGCAGACTGACA TGGAAGAAGCCAAGACACAAGAAAATCGGAAGTTGCAACAACAATTGCAG GAACTGCAATTGCAGTCCAAGGAGACCAAAGATCTGTTGAAAAGGGAACG GGAAATTGCAAAAGAAGCGCTAGAGAAAGCTTCGTTAGTACCAGAGGTCC AAGTTGATACAACTCTTATTGATAAACTCACTGCTGAGAATGAGAATCTT AAGGTATGTATGGTGAATGAGTTTGCTGTTCATTGCATCAGATTTGTTCA TCTGCTGGTGTAATATATTATTGAGAACCTTCAAATTGGGTGAAATGCAT ATTGCATAACACTGCATCATAAATTTGTGCTAAGGAGTTAAAGGCAAACT TATTTGATGAGAATTGAAGTACACTTTGTAGACTGTAATATTTAGTATCC TACTATGAGAAATGCTAATGAGCTATGCCCCGAAGCATGCTAATCCTCCA TCTGGTTGATGGTGCTGTTGCCTTGAGCAGACCAGGAAACTTTAGTCTCG AATGGGAATAATTTAGTTTTGCAGGTGCTTATGGAGGCTTGAACCATATG AAACCATATTGTTTGAACATAACCATGTTGCTACAAGTTGTGGTATTGTG CTTAAATATTTTTCTCTCGAGCATGCAAGAGATTTGCGCATCATTTCATT AACAGAGAAAAAAAAGAAGAAAAAGTACAGAGGGAGAAGAATCCCCCTCC CCAAGGGAAACACTAGACCAGAGCAACTAGCCTTCCACAACTAACAAGAC CTGTGACTATGGGACACAAGGCCAAAGAAACTAGTCTAGAACAGGCAAAG TGACAAAGAGTACCAACAAAAACTTAGGGAAAAATTTAAGCCACAACAAG CGACCCAGACAATAACTCCTGGAGTCCTTTTGCACCAGCAGAGCACTATA GGATGCATTCATTTGTGATTGTCTGCAATTATTTGTGATGCTTGGACTTG CACCATTAAAGATACACATTCCTGTGCTTCCAAATTTCCCAGGCCGCCAG GGAAATGAGTGTATTAAGCCCTTTTTTCATCTCGTTAGGTACCTTGATTG CCTGGTACGCCCAACTTGAAAATTTGCTAGTAGAAACCGGGCTGATGGAG CTCAACCCCAATCTCTGAAAAATAATAAACCAGACCTGTCTAGCAAAGAC ACAAGAGATCAACAAATGCTGGATGGACCTCTCCTGCCTGATCGCAAAGA GGACAGGCCACTGGATGAGGGAGTCCTCTCTTTGCTAGGCGATCACCAGT CCAGCATTTGTTGTTGATTGCAAGCCAGTTGAACAACTTGCAGTTTTGAG GAGCCCAGCTCTTCCAAATTCTTTTCCATAGAGCGAAGCGAATGGAGCCA CAAAAGTAAGCATTATAGGCTGGTTTGCTAGAATAAATACCAGACATGGT GAGCTTCCATCGGTGCTGATCTTCAACCTCCTCTTGCAGCAACATACTAT CAACCAAATCCCATAGCAGGAGGTACTCAGGACTGGGACAGAGTGTACCT TTAACGTCTGAGACCCAACGGCGGGTCTCCAAAGCCTGTGCTTAAATATT GTTGATGCGAATTAGCCTAGTAACTTTAGTTGTCTGTAATCCAAAACATA AGCATGGTCTGTTTTGACCATTAAATTGTATTTTTGGATTTTGAATCCAT TATAGTCATCTCCAGGTGCTTATCTGTGATTTTTTTATTAATCTACTATT TTTTTTGGTTTCCCAACATGGTTTCGACACCAATATTAAACAACCACCAT TCAACCATTGTATTGCCTTGGAGAAACTTCCCAATCTTACCTGGTGAATT CTAGCAAATGGTCATGGTGAAATGCTCATCTTTTCCTTGTAGCCCATGCT TTCAGGAAAGCTAACAAATGCTGATTGGAAGTGCCTCTTGATCTATCTTA GTTCTTTCACTGAAGCTTGTGATATCATCTGGCTCTATAAATTCAACCTC TTTCCTATCTTTCCTTTATATTACTACAAAAGATGGTGACATGGCCCTGT TGTTTTAAACTTTTAGGCTTTAGTGGGCTCTCTTGAGACCAAAATTGATG AAACAGAACATAAGTTTGAAGAAATGAAGAAAGCAAGGGAAGAGTGGCTG AAGAAAGCTACAGATGCCGAGTCAAAGATAAATGAACTGACCAACACAAT GCTAAGGTTGGTGTTGTCTACATATGTAATCTTTTTTTGTGCTGACGCAT CATGTGCATGTTTTACGGATTGCATTGAAAATTGTCTATTCTGCATGGTG GCAGTTTTCAAGAAAAGGTAACTACTATGGAAGCAGAAAATCAACTACTT AGGCAGCAGGCACTGTTGCGTACTCCTGTTAGAACAATTCATGAAAACAC ATCTCCGAAATCTGTATGTGTTCTCTCCATTCCTTGAGTCATACAAATGT TCACCTGTTGGTGTTTTCTTTCTTGTATTTCTACTTCTGCATATTTTACT TGTTATTAATATTTTAAACTACACATTTTCATTGTTGAAATGTTTCAATG TCTTTCTACCTTTGCAGAATTTGACTAATGGCAGTCTACGCATTGATGAA CAAAAGGTCAGAAGCATATAATATATTCAATTGCCAACTACTATTTCTGT TATGTTTGAATCTAAAATTGATCACTCTCTCTAGACACCTCATGGAACTC CTCTTGCTCCCAAAGATTATGGGAGCTTTGGACAGCCTAGAGCATCCTTT TTTGAGAGGCAGCATGTATGTTAA
back to top

Coding sequence (CDS) from alignment at Sh_004L19:62830..78053+

>Sh_004L19_t000060 ID=Sh_004L19_t000060|Name=Sh_004L19_t000060|organism=R570 Sugarcane cultivar|type=CDS|length=3321bp|location=Sequence derived from alignment at Sh_004L19:62830..78053+ (R570 Sugarcane cultivar)
ATGGCATCCAAAGTCCGCTTTACAGTGGGTTCTCATGTTTGGGTTGAGGA
TGCTGAGGTGGCTTGGATTGATGGGCTGGTGGAGGAGGTCCAAGGAGATG
AATTAATTATAAACTGCACTTCTGGGAAGAAGGTTACTGCCAATGTCTCA
AGTGTGTATCCTAAGGATGCAGAAGCGAAGCGCTGTGGCGTTGAGGATAT
GACGAGGCTAGCTTATCTTAATGAACCAGGAGTTCTACAGAACTTAAAGT
CTAGATATGCAATGAATGAAATATATACTTATACTGGCAACATTTTAATA
GCTGTTAATCCATTTCAAAGACTTCCCCACCTTTATAACAATCACATGAT
GGGAATCTATAAAGGCGCAGAATTTGGCGAGCTGAGCCCTCATCCTTTTG
CCATTGCAGATCGTGCATATAGGCTTATGATGAATTATGGTAGAAGCCAA
GCCATATTAGTGAGTGGTGAAAGTGGAGCTGGTAAGACAGAAAGCACTAA
AAGTCTTATGCAGTATCTTGCATTTATGGGTGGCAAAGCTCAATCTGGGG
GAAGGTCAGTGCAGCAACAAGTACTGGAGTCCAATCCTGTTCTTGAGGCA
TTTGGAAATGCAAAAACAGTCAGGAATAATAATTCAAGTCGTTTTGGCAA
ATTTGTTGAGATTCAGTTTGACAAGAATGGGAAGATCTCAGGAGCTGCCA
TAAGGACTTACCTCCTAGAAAGATCTCGTGTCTGTCAAATATCTGATCCA
GAAAGGAACTATCACTGTTTTTACATGCTATGTGCTGCACCACCTGAGGA
CCGTGAGAGATATAAACTGGGAGATGCCGCATCATTTCACTATCTTAACC
AGTCTAGTTGCATTAAGCTTGATGGGATGGATGATGCTTCAGAATATATC
ATAACTAGGAGGGCAATGGACATTGTGGGCATCAGTTCTGATGAACAGGA
TGCAATATTTAGAGTTGTCGCTGCCATTCTTCATTTGGGCAATGTGGAAT
TTTCAGAAGGGAGTGAAGCAGATTCTTCTGTACCTAAAGATGACAAGTCC
CAGTTCCATCTTAGGACAGCTGCAGAGCTTTTCATGTGTGATGAGAAAGC
TCTTGAGGAATCTTTGTGTAAGCGAGTTCTGGTAACACGTGGTGAAAGTA
TTGTGAAAAATTTAGATGCACGAGCAGCAGCTCTCAGTAGAGATGCATTG
GCCAGAATTGTTTACTCTCGTTTGTTTGATTGGCTTGTAAATAAGATAAA
TACTTCAATAGGACAAGATCTAAGTTCAAAGCTTCTGATTGGTGTACTGG
ATATATATGGTTTTGAGAGTTTCAAGACAAACAGTTTCGAGCAGTTTTGC
ATCAACTTAACTAACGAGAAGCTGCAGCAACACTTTAATCAGCATGTGTT
TAAGATGGAACAAGAGGAATATACAAGGGAAGAAATTGATTGGAGTTATA
TCCAGTTCGTAGATAACCAAGAGATTCTTGATCTTATTGAGAAGAAACCA
GGGGGTATAATTGCTCTACTGGATGAAACTTGCATGTTGCGAAATTCAAC
CCATGAAATATTTGCTGAAAAGCTGTATCAAAAATTTAAGGGGAACCCAC
ATTTCAGTAGGCCAAAGTTCTCACGGTCTGATTTCACTATTCATCACTAC
GCTGGAAATGTTACGTATCAAACAGATCTGTTCTTGGATAAGAACATTGA
TTATGCTGTGAATGAGCATCAAGTTTTGTTACATGCTTCGAGATGTTCAT
TTGTTTCCAGTCTTTTTCCACCTTCTGAAGAATCAGCTAAATCTACGAAA
TTTACATCGATAGGTTCAAGCTTTAAGCAACAATTACAAGCTTTGCTGGA
AACTCTGAGTGCAACAGAGCCACATTACATCCGCTGCATAAAGCCCAATA
ATGTTCTCAAGCCAGCAATTTTTGAGAACAGTAATGTTCTCCAGCAACTT
CGATGTGGGGGAGTATTAGAGGCAATAAGAATAAGCTGTCTAGGATATCC
AACAAGGAGGAGATTTGACGAATTTGTTGACCGTTTTGGTGTTTTACTAC
CTGAAGTTCTTGGTGAAAGTTATGATGAAGTTACTGCTACAAACATGCTT
CTTGAGAAAGTCAATCTCACAGGCTATCAGATCGGGAAAACTAAATTGTT
TTTACGTGCTGGTCAAATGGCTGAATTAGATGCTCTGAGAACTGAGGTCT
TGGGCCGTTCTGCCAGTAAAATCCAGAGAAAAGTACGGTCATACTTGGCT
CGCAAAAATTTCATTCAACTGCGAATATCTGCTACTCAGCTCCAGGCTAT
TTGCAGAGGACAAATTGCAAGACATTATTACGAAGATCTCCGCAGGGAGG
CTGCTTCATTGACCATACAAACCTGCTATCGTATGCACTTTGCAAGGAAG
AACTACAGAAATCTCTGTACTGCATCAACTACTATCCAATCTGGTCTACG
TGGTATGGCTGCTCGCAAGGAACTCCAGTTCCGTCAGCAAACAAATGCTG
CAGTGATCATTCAGAGTTTCTGGCGTAGTTATGTAGCACGCTCTCGATTC
ATGAGCTTGAAGAAGGCAGCCATTGCTACCCAATGTGCTTGGAGAGGAAG
AGTGGCCAGAAAAGAGCTTCGGAAACTTAAAATGGCTGCTAAAGAAACTG
GTGCTCTCCAAGCTGCCAAGAATAAATTAGAGAAGCAAGTTGAGGAGCTC
ACCTGGCGGCTGCAACTAGAGAAACGCATGAGGACTGACATGGAAGAAGC
CAAGACACAAGAAAATCGGAAGTTGCAACAACAATTGCAGGAACTGCAAT
TGCAGTCCAAGGAGACCAAAGATCTGTTGAAAAGGGAACGGGAAATTGCA
AAAGAAGCGCTAGAGAAAGCTTCGTTAGTACCAGAGGTCCAAGTTGATAC
AACTCTTATTGATAAACTCACTGCTGAGAATGAGAATCTTAAGGCTTTAG
TGGGCTCTCTTGAGACCAAAATTGATGAAACAGAACATAAGTTTGAAGAA
ATGAAGAAAGCAAGGGAAGAGTGGCTGAAGAAAGCTACAGATGCCGAGTC
AAAGATAAATGAACTGACCAACACAATGCTAAGTTTTCAAGAAAAGGTAA
CTACTATGGAAGCAGAAAATCAACTACTTAGGCAGCAGGCACTGTTGCGT
ACTCCTGTTAGAACAATTCATGAAAACACATCTCCGAAATCTAATTTGAC
TAATGGCAGTCTACGCATTGATGAACAAAAGACACCTCATGGAACTCCTC
TTGCTCCCAAAGATTATGGGAGCTTTGGACAGCCTAGAGCATCCTTTTTT
GAGAGGCAGCATGTATGTTAA
back to top