Sh_004L21_p000080

Overview
NameSh_004L21_p000080
Unique NameSh_004L21_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length362
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004L21contigSh_004L21:82000..83851
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC5.1.3.3
EC5.1.3.21
InterProIPR011013
InterProIPR014718
InterProIPR008183
InterProIPR015443
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004L21_t000080Sh_004L21_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004L21_p000080 ID=Sh_004L21_p000080|Name=Sh_004L21_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=362bp
MARAALLACSLLLLCLALAGGTDAAKKTVGVYKLKNKKGDFSIKVTNWGA
TLMSVIVPDSKGNLADVVLGYDKLAQYEDASSAFGTVVGQVANRIANGSF
VLDGKTIRLNKDGTTVLHGGHRGFNRVIWTVKEYVPGGDSPYITLYYHSF
DREQGFPGDLDVYVTYQLGCSPYELKARMNATALNKATPVNLANHAYWNL
AGDGSGDALGHLIKVFASRYTPVDASMIPTGEIAPVSGTPYDLRAPTLLG
SRIKHVSGAGMAGFDINYAVDGDGFRQVAYFRDPASGRALELWANRPGVQ
LYTSNWLNNVKGKGGRVYGQYGAVCLETQAFPDAVHHPNFPSEIVRPGGA
YQHDMLFKFSF*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0030246carbohydrate binding
GO:0016853isomerase activity
Vocabulary: Biological Process
TermDefinition
GO:0005975carbohydrate metabolic process
GO:0019318hexose metabolic process