Sh_004O05_p000020

Overview
NameSh_004O05_p000020
Unique NameSh_004O05_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length590
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004O05contigSh_004O05:5125..8118
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR014881
InterProIPR017117
InterProIPR029060
InterProIPR033411
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004O05_t000020Sh_004O05_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004O05_p000020 ID=Sh_004O05_p000020|Name=Sh_004O05_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=590bp
MEAWPPLAPAAAAAAAPTAAASDDAAAPPAGAGAWGAAATAQRKAVEKES
AAQAVSRIVANCANSSGVAVAVVDANAVISGGSALSTSAGRLVTVPEVLE
EVRDAAARRRLGLLPVPVETVEPAPEFVKKGRCSITKFARETGDIQTLSD
VDIKIIALAYMLEAEIHGTSHLREHPPPLREVNVRKLSEAPLPGWGSNVP
NLKEWEELDQISEAGGDINSRILPLKDIENQDIPMSETNSVSEAQEDTEH
QPSEKDAPVAWEEDENNVGWMPAVSRSTHRRYLRRRARRDALKESGQSFE
TSSVAPSIDDDKVLSENGGLEHGLTSTDGLSSVPEKISASSDGFEHQTEN
DTEIAGEHLHSDQLAYGDDTDACTKELDNLDIKGEDEGGDDAHSIDDESS
EQSWTLRSLSESTVACVTSDYAMQNVILQIGLRLIAPGGMQIRQMHRWVL
RCHACYKVTQEVGKIFCPKCGNGGTLRKVSVTVGENGITMASRRPRVTLR
GTKFSLPMPQGGRDAITKNPILREDQLPQKVLHPKSKKSSKEDDFLGVDD
IFSHSGDKKAPLKPPVRKALAMFSGKRNPNDNHFSRKKH*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004521endoribonuclease activity
Vocabulary: Biological Process
TermDefinition
GO:0000469cleavage involved in rRNA processing
GO:0042274ribosomal small subunit biogenesis