Sh_004O05_p000030

Overview
NameSh_004O05_p000030
Unique NameSh_004O05_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length298
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004O05contigSh_004O05:8717..10097
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR009057
InterProIPR001005
InterProIPR017930
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004O05_t000030Sh_004O05_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004O05_p000030 ID=Sh_004O05_p000030|Name=Sh_004O05_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=298bp
MGCRSCEKPKMNYRKGLWSPEEDQRLRDYILKHGLGCWSAVPAKAGLQRN
GKSCRLRWINYLRPGLKRGMFSQEEEDVVINLQAKLGNKWSQIAMHLPGR
TDNEVKNYWNSYLKKRVMQAQGALSNSSPKSPPELTSMSTTELSSMSMSM
HQHHHVKNSSGGGGGSTTTSHDYDGNISGSHALSAPPLAQQPFDHQAARS
FVFSDWAPAAPESYSVSTHWPASTASSGNVTPSHGHGGGAFGDQMSGTYG
AGALPPHQDHHQSAAATAGIAGSGYFDLLNMGDIYGGFSSTNDDLLF*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003677DNA binding