Sh_004O05_p000060

Overview
NameSh_004O05_p000060
Unique NameSh_004O05_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length74
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004O05contigSh_004O05:44183..44404
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR004264
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004O05_t000060Sh_004O05_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004O05_p000060 ID=Sh_004O05_p000060|Name=Sh_004O05_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=74bp
MLSNEKVAKATVVSVNPNNKLAGVALGTKFCEVIVNVVLRRETLVPRPYA
EIKTLGDAVKMPVAWPFNRVMST*
back to top