Sh_004O05_p000090

Overview
NameSh_004O05_p000090
Unique NameSh_004O05_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length494
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004O05contigSh_004O05:94237..96246
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC1.11.1.6
InterProIPR011614
InterProIPR002226
InterProIPR020835
InterProIPR010582
InterProIPR018028
InterProIPR024708
InterProIPR024711
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004O05_t000090Sh_004O05_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004O05_p000090 ID=Sh_004O05_p000090|Name=Sh_004O05_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=494bp
MDPTKFRPSSSHDTTVTTTNAGAPVWNDNEALTVGPRGPILLEDYHLIEK
VAHFARERIPERVVHARGASAKGFFECTYDVTSLTCADFLRAPGVRTPVI
VRFSTVIHERGSPETIRDPRGFAVKFYTREGNWDLLGNNFPVFFIRDGIK
FPDVIHAFKPNPKSHVQEYWRVFDFLSHLPESLHTFFFLFDDVGVPTDYR
HMEGFGVNTYTFVNAAGKSHYVKFHWKPTCGVRSILTDEEAALVGGKNHS
HATQDLYDSIAAGNFPEWKLFVQVMDPDTEEQYDFDPLDDTKTWPEDLLP
LQPVGRLVLDKNVDNFFNENEQLAFGPGLVVPGIYYSDDKMLQCRVFAYA
DTQRYRLGPNYLMLPVNAPRCAHHNNHYDGAMNFMHRDEEVDYYPSRHAP
LRQAPPVPVPARPVVGKRQKATIRKPNDFKQPGERYRSWDADRQERFVRR
FADSLGHPKVSQELRSIWIDLLSKCDASLGMKIATRLNMKPNM*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004096catalase activity
GO:0020037heme binding
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006979response to oxidative stress