Sh_004O05_p000120

Overview
NameSh_004O05_p000120
Unique NameSh_004O05_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length658
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_004O05contigSh_004O05:118924..121898
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR013126
InterProIPR018181
InterProIPR029047
InterProIPR029048
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_004O05_t000120Sh_004O05_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_004O05_p000120 ID=Sh_004O05_p000120|Name=Sh_004O05_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=658bp
MVSQLHYISAAAAAAADVYVRETKKLGTVIGIDLGTTYSCVGVYKNGHVE
IIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRK
FEDKEVQRDMKLVPYKIINKDGKPYIQVKIKDGENKVFSPEEISAMILGK
MKDTAEAYLGKKITDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEP
TAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTH
LGGEDFDQRIMEYFIKLIKKKYSKDISKDNRALGKLRREAERAKRALSNQ
HQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMEDAGLE
KSQIHEIVLVGGSTRIPKVQQLLRDYFDGKEPNKGVNPDEAVAFGAAVQG
SILSGEGGDETKDILLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQV
FTTYQDQQTTVSIQVFEGERSMTKDCRLLGKFDLSGIPPAPRGTPQIEVT
FEVDANGILNVKAEDKGTGKSEKITITNEKGRLSQEEIDRMVREAEEFAE
EDKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKKKVEEALKE
ALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSAVYQRSGGAPGGDSEGGV
DDDHDEL*
back to top