Sh_005D21_p000060

Overview
NameSh_005D21_p000060
Unique NameSh_005D21_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length922
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005D21contigSh_005D21:63235..68926
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR028299
InterProIPR027417
InterProIPR001943
InterProIPR018368
InterProIPR003959
InterProIPR004176
InterProIPR019489
InterProIPR003593
InterProIPR001270
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005D21_t000060Sh_005D21_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005D21_p000060 ID=Sh_005D21_p000060|Name=Sh_005D21_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=922bp
MAGTLLQSVALGTTFGGRISTQRWRSHGTRRPASMLAMSLSRPVKMSAFV
GLRSVHSFSVTPTVSNSRPTVASYRSSRRTRRSRFVTRAMFERFTEKAIK
VIMLAQEEARRLGHNFVGTEQILLGLIGEGTGIAAKVLKSMGINLKDARV
EVEKIIGRGNGFVAVEIPFTPRAKRVLELSLEEARQLGHNYIGSEHLLLG
LLREGEGVAARVLESLGADPSNIRTQVIRMIGETTEAVGAGVGGGSSGNK
MPTLEEYGTNLTKLAEEGKLDPVVGRQPQIERVVQILGRRTKNNPCLIGE
PGVGKTAIAEGLAQRISTGDVPETIEGKKVITLDMGLLVAGTKYRGEFEE
RLKKLMEEIKQSDEIILFIDEVHTLIGAGAAEGAIDAANILKPALARGEL
QCIGATTLDEYRKHIEKDPALERRFQPVKVPEPTVDETIEILRGLRERYE
IHHKLRYTDEALIAAAKLSYQYISDRFLPDKAIDLIDEAGSRVRLQHAQV
PEEARELDKELKQITKQKNEAVRSQDFEKAGELRDREMELKAQITAFIDK
SKELTKAEEESGETGPMVNEADIQHIVSSWTGIPVEKVSSDESDKLLKME
ETLHKRVIGQDEAVVAISRSIRRARVGLKNPNRPIASFIFAGPTGVGKSE
LAKALAAYYFGSEEAMIRLDMSEFMERHTVSKLIGSPPGYVGYTEGGQLT
EAVRRRPYTVVLFDEIEKAHPDVFNMMLQILEDGRLTDSKGRTVDFKNTL
LIMTSNVGSSVIEKGGRKIGFDLDSDEKDSSYSRIKSLVIEEMKQYFRPE
FLNRLDEMIVFRQLTKLEVKEIADIMLQEVFDRLKAKDINLQVTEKFKER
VVDEGYNPSYGARPLRRAIMRLLEDSLAEKMLAGEVKEGDSAIVDVDSEG
KVIVLNGQGGIPELPTPAITV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0019538protein metabolic process