Sh_005E09_p000040

Overview
NameSh_005E09_p000040
Unique NameSh_005E09_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length1049
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005E09contigSh_005E09:62785..67951
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR015712
InterProIPR007646
InterProIPR007120
InterProIPR007121
InterProIPR007642
InterProIPR014724
InterProIPR007641
InterProIPR007645
InterProIPR007647
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005E09_t000040Sh_005E09_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005E09_p000040 ID=Sh_005E09_p000040|Name=Sh_005E09_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=1049bp
MRETILALPYICFVKFQVFIAEEQRFLSRIWVTDRPSWNASYTSQIRQEK
IDIKLVPSKRNEICKVINIYFMGTIMPIWVVFFALGVSSDKEAFDMIDIL
DCDASIVNIISSTIKESHEEFEGFRTPGRARQYVDELIRKSKFPPKESFD
EYVCRYMFPSVNGVRSKALFLGYMVKCLLMAYSGNRKCDNKDDFRNKRLD
LACQLLRRELWTHIKRAERRMVKLMQRDLSNNGSLQDLRCYVDASIITNG
LNRAFSTGSWQHPFKKERCSGVVATLRRTNPLQMMSDLRKTRQWFAYSGT
VGDARYPNPSYWGKLCFLSTTDGEKCGFVKNLAVTAVVSSVVRKPLIDTF
VSCGMKKLNDISLQDISGKFRIFLNGDLLGVCADPHELTSRLRSLRRSKL
IDPQVEIKMDKHHKEVRVFSDPGRILRPLLVVENLRRITRPKDGLYSFQE
LMDQNIVELIGVEEEEDIRCASGIRHLFAGEKEDGSSGYTHCELDPSFLL
GLSCSLIPFANHDNARRVLMQAQKLSQQAIGYSPTNSHIRLDTLSHQIFY
PQRPLFKTVVSYGLGKAETAYSFGQKDDFNTPEYFNGQNAIVSVNVHQGF
NQEDSLVLNRASLERGMFRTLHFKSYKAQVENKEITRRLKHRESINFGKV
QSKRGKVDSLECEGLPYVGASLQSGDIVIGKVSESGEDHSAKLMHTEQGM
VDKVVLSANDDGVNFATVTLRQSRSPCVGDKFASMHGQKGVVGLLDSQEN
FPFTCQGIVPDMVINPHGFPTRQTPGQLLEAALGKGIAMGGTVRYTTPFT
TPTVDVITEQLHKAGFSRWGEESVLNGQTGERMKSLVFMGPTFYQRLVHM
AEDKVKFRNTGPVHPVTRQPVEDKKRFGGVKFGEMERDCMLAHGAAANLH
ERLFMLSDFSQMHICQACERVANVIMRPAEGGSKKVHGPYCMFCRSAERI
VRVNVPYGSKLLYQELFSMGICLKFDTEGGVTTTTTAAPASGSASSTPDD
RPTTGVWQDGLQEERPRRLRTLNPRIFGPDWQNKWTRCRALRSVVSSL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003899DNA-directed 5'-3' RNA polymerase activity
GO:0032549ribonucleoside binding
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006351transcription, DNA-templated