Sh_005E09_p000060

Overview
NameSh_005E09_p000060
Unique NameSh_005E09_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length229
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005E09contigSh_005E09:69214..69900
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR015712
InterProIPR007644
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005E09_t000060Sh_005E09_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005E09_p000060 ID=Sh_005E09_p000060|Name=Sh_005E09_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=229bp
MGEPQMDGDQSLVISDTDMMDCLNLDGYGDVEDPHKEGAKGERQPSGKVD
ELQSTMDVDLTGITSVEDEGNEKQNAMDVDLKEILPEEDEGKRKASSDLP
SHVPVDFDVASLEKFCKEASRSFFSEIGLVSHQINSYNHFVSHGLQELFD
SFGEITVEPDYDPSNKDGAWKHATVKFGRVKLGEPVFMVDNSDLEQQDLK
FKPRHARLQKMTYASRMNVEMTVQVRMS*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003899DNA-directed 5'-3' RNA polymerase activity
GO:0032549ribonucleoside binding
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006351transcription, DNA-templated