Sh_005F05_contig-1_p000120

Overview
NameSh_005F05_contig-1_p000120
Unique NameSh_005F05_contig-1_p000120
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length412
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005F05_contig-1contigSh_005F05_contig-1:80090..82272
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001752
InterProIPR027417
InterProIPR019821
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005F05_contig-1_t000120Sh_005F05_contig-1_t000120R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005F05_contig-1_p000120 ID=Sh_005F05_contig-1_p000120|Name=Sh_005F05_contig-1_p000120|organism=R570 Sugarcane cultivar|type=polypeptide|length=412bp
MAAPGASAGGRRASTSRARRAPAAAAESNENEDIAAAPSSSSSSAFALSS
APAPHFSLPPRSPLAAIADPGRNPRSAPATPKSLAATPRASAAGSGARDR
TSSVGAAKRVFDLRDVAAAEVPLEVPHFELDEDPAFWKDRNVQVLIRIRP
ISDAENATHGQKRCLLQDSSKTLSWTGHPETMFTFDHVACETISQEKLFR
VVGLPMVENCMSGYNGCLFAYGQTGSGKTYTMMGELTKLGNELSKDAGLT
PRVFEYLFRRINEEEERRREEKLKYICKCSFLEIYNEQITDLLEPSSTNL
QIREDIKKGVYVENLMECYVSSVEDVMLLLLQGVANRKMAATNMNSESSR
SHSVFTCVIESRWESDSMTHLRFGRLNLVDLAGSERQKSSGAEGERLKEA
ANINRSLSTLG*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0008017microtubule binding
Vocabulary: Biological Process
TermDefinition
GO:0007018microtubule-based movement