Sh_005F18_p000040

Overview
NameSh_005F18_p000040
Unique NameSh_005F18_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length789
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005F18contigSh_005F18:70078..74730
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR011009
InterProIPR000719
InterProIPR017441
InterProIPR008271
InterProIPR027084
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005F18_t000040Sh_005F18_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005F18_p000040 ID=Sh_005F18_p000040|Name=Sh_005F18_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=789bp
MENRDSFPRPPAPSYPSLTRAVAVPTGGDTAATNLTSSSGSSSSLTLSPP
RFLQQIHAAVKRQRPFGEWIRLWSPTPSDELYVMLSRVGPMQSKLPRATR
VLVSGGERATKVGACPSVAKDPERKVTQPQRGLLGSSRLPNATPDQSTPK
LGSSTPDELMLTASSSMLKSTIDTHAQSVGQKNNEANLLIDTEKSALEAL
SSQITSCNALMGESFKKGQLDLDGNPQLTSQSDNIGITVDSRMDSMSSYL
HSVSLTAGDNFPANQGAQYDHQQNHQELEIVGAEVDMDIKYDAPNLSRRG
IDEARNHNHGEPMTRFSAIGSSVTAISLHSGPTVQSLQTPQVSRYTSPVQ
MPESAVESSKGVLGHGSQKEPAGATGVGDWNPHNQHVRNLGNGATDKAVS
SIGRLRSEGLPANDQSTSARDGGASRPNKGEKERHKKNYDPNVFFKVNGK
LYQKLGKIGSGGSSEVHKVISSDCIIYALKKIKLRGRDYPTAYGFCQEIE
YLNKLKGKSNIIQMIDYEVTDKSLLLESSVPPRDGRIKDDHFIYMVLEYG
EIDLANMVALKWKERSNSNMKIDENWLRFYWQQMLEAVSTIHEERIVHSD
LKPANFMLVRGSLKLIDFGIAKAIMNDTTNIQRDAQVGTLNYMSPEAFMC
NDTDSGGNVIKCGRPSDIWSLGCILYQMVYGKTPFADYKTFWAKYKEVTD
RNHKILYEPVDNPWLVDLMQRCLAWDRNERWRIPQLLKHPFLNPPVPKDL
PPSDDDPCWLLMERIRVHWDNPVVQKLRSLIEELDGDQ*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004712protein serine/threonine/tyrosine kinase activity
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO:0007093mitotic cell cycle checkpoint
GO:0051304chromosome separation