Sh_005G15_p000010

Overview
NameSh_005G15_p000010
Unique NameSh_005G15_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length584
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005G15contigSh_005G15:18424..21922
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC3.4.23.2
EC3.4.23.45
EC4.2.1.148
InterProIPR008139
InterProIPR001969
InterProIPR021109
InterProIPR001461
InterProIPR033869
InterProIPR011001
InterProIPR033121
InterProIPR008138
InterProIPR007856
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005G15_t000010Sh_005G15_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005G15_p000010 ID=Sh_005G15_p000010|Name=Sh_005G15_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=584bp
MQQVDSKSPSHSPVALSIDFQNLIRGPMLPHEGETASSDWRLVCPIYPPL
FPLEFSPVSTSFPLLSGPGFGSTRQKLRLGTTGQKHLLLLACFWVLSCSL
LLHASSDGLLRINLNKKKLDKEALTAAKLAKKESRLRRSVGAGQYLGAST
DDIVPLDNYLDTQYFGEIGIGTPSQNFTVIFDTGSSNLWVPSSKCYFSIA
CYLHHRYKSTKSKTYKKNGESCTITYGSGQIAGFFSEDNVLVGNLVVQNQ
KFIETTRETSPTFIIGKFDGILGLGFPEISVGEAPPIWQSMKEQKLVAKD
VFSFWLNRDPDASAGGELVFGGVDPKHYKGNHTYVPVTRKGYWQFDMGDL
LIGGHSTGYCAGGCAAIVDSGTSLLAGPTTIVAQVNHAIGAEGIISTECK
EVVREYGEMILELLIAETSPQKVCTQIGLCVFDGAHSVSNPIESVVEKQN
LGSDLFCTACEMAVVWIENQLRENKTKELILNYANQLCERLPSPNGESTV
DCDQISKMPNLAFTIANKTFTLTPEQYIVKLEQAGQTICISGFMAYDVPP
PRGPLWILGDVFMGAYHTVFDFGENRIGFAKSA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004190aspartic-type endopeptidase activity
Vocabulary: Biological Process
TermDefinition
GO:0006508proteolysis
GO:0006629lipid metabolic process