Sh_005G15_p000020

Overview
NameSh_005G15_p000020
Unique NameSh_005G15_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length112
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005G15contigSh_005G15:45041..46483
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005G15_t000020Sh_005G15_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005G15_p000020 ID=Sh_005G15_p000020|Name=Sh_005G15_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=112bp
MCSVPFTQTQPSPSPSSSPPSDSRERKPRKPRICTRKMRGGAKIRTPTPT
PTPTPTPTPTPSPGPELDPLARIVLMIPTAPLPTTGLHNKDLIPQVEQGV
EILKTNAVHSH*
back to top