Sh_005G15_p000040

Overview
NameSh_005G15_p000040
Unique NameSh_005G15_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length572
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005G15contigSh_005G15:55926..59620
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR015421
InterProIPR015424
InterProIPR015422
InterProIPR000192
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005G15_t000040Sh_005G15_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005G15_p000040 ID=Sh_005G15_p000040|Name=Sh_005G15_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=572bp
MSSWCRGCRRGLLFSTAFRPFGSRWAVGPVAAPVHAADDAGERLNPGGPS
PARRGPPRVASPIHPQHTRAHHCLSPITPNSPSLSSPSRPANPSAAAMAS
DPASDDAAAAENGHGNGNGHGNGNGNGPSPSKRPRSVISAAEIRAEFAHH
DAAVARVNNGSFGCCPASVLAAQAHWQRLFLAQPDAFYFHGLQQGLRRSR
AAVAEAVGAGDVSEVSLVDNATTAAAIVLQHAAWSFAEGSFASGDAVLML
HYAYGAVKKSIHAYVARAGATVVEVPLPFPVASADAIIAEFRAALAVAKE
GGRRVRLAVIDHITSMPSVVIPVKELVAICREEGVDKVFVDAAHSIGQVP
VDVRDIGADFYTSNLHKWFFCPPAVAFLHTRKDDPIANQLHHPVVSHEYG
NGLPMESGWIGTRDYSAQLVVSEAIDFVNRFEGGIEGIRSRNHEKVIEMG
RMLAEAWGTFLGSPPELCGSMVMVGMPGCLGVESDDDALRVRTMLRKDFQ
VEVPIYYNSRRVEGQEMAKDKNGDPVTGYVRISHQVYNVTEDYERLRDAV
NKLVSEGFTSSKLRPSEKQEA*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity