Sh_005H13_contig-1_p000010

Overview
NameSh_005H13_contig-1_p000010
Unique NameSh_005H13_contig-1_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length961
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005H13_contig-1contigSh_005H13_contig-1:8577..11459
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001584
InterProIPR012337
InterProIPR025724
InterProIPR013103
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005H13_contig-1_t000010Sh_005H13_contig-1_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005H13_contig-1_p000010 ID=Sh_005H13_contig-1_p000010|Name=Sh_005H13_contig-1_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=961bp
MFAGATPGFYPASPWGTPSSASPGPAGWSPKALARFFSTMGLTPPVGPEW
IADSGATYHTTPDPGILSSARPPSHPSSIMVANGSCLSVTSVGAVGTHGS
FHLPDVRIAPSMIHNLLSIRRFTADNSCSVEFDSAGLTVKDLATRRPLLR
CDSTGPLYTVRFLASASPSSLLSAAFATTSSTTWHRRLGHPGRDALIQLS
HSSDIRCTRAHDEHLCHACQMGRHVRLPFSSSSHAAHIFYLVHCDLWTSP
VLSISGYKYYLVVVDDFSHYSWTFPLRAKSEAFPTLHHFFAWVSTQFGLT
IKAVQCDNGREFDNSTSRVFFLSRGVQLPMSCPYTSSQNGKAERMIRTTN
DTVRTLLLQASLPACFWAESLHTSTYLHNRLPSAACSAPTPHHALFGTPP
RYDHLRVFGCVCYPNTTVTAPHKLAPRSTLCVFLGYSPYHKGYRCYDLTS
RRVLISRHVVFDESVFPFSTITTPSASELDLSSLFPTDAVVEPPLSLFPA
GTAAPCPSSPSTGDSPDPAPHSSMDGSPSGLAPVIPADGGPGPSPPAQHA
RFAQPVLVYQRRARTAPAPSPPLMAPSPESPLGPSSSPPGTPEPSQRPPT
ARVETLMYHPPLLHRHPRHVHPMVTRHAAGTLQPRALATLPGDSQVSPVP
SSVREALSDPHWRHAMEEEYAALLANQTWDLVPRLPDSNVVTGKWIWTHK
RRADGTLERYKARCVLRGFTQRPGVDYDETFSPVVKPATVHTVLSLALTR
SWPVHQLDVKNAFLHGLLTETLYCSQVVGFVDSSCPDMVCRLNRSLYGLK
QAPRAWNHRFAAFLRSLGFVEAKSDTSLFIYHHGAETAYLLLYVDDIVLT
ASSESLLRRIITSLQREFAMKDLGVLHHFLGVTVAPHPAGLLLHQRQYTL
DILERAGMTDCNPCSTPVDTQGKMSEAEGNPVTDPTAYRSFAGALQYLTF
TRPDIIYAVQ*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0015074DNA integration
Vocabulary: Molecular Function
TermDefinition
GO:0003676nucleic acid binding