Sh_005H13_contig-1_p000080

Overview
NameSh_005H13_contig-1_p000080
Unique NameSh_005H13_contig-1_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length93
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005H13_contig-1contigSh_005H13_contig-1:60474..69782
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005H13_contig-1_t000080Sh_005H13_contig-1_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005H13_contig-1_p000080 ID=Sh_005H13_contig-1_p000080|Name=Sh_005H13_contig-1_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=93bp
MLCIRVVSAFEEAEVVDQASGEERSSVGSGPGGEVLESESVVVFEQVSAF
EEAEVVDQASGEERSSVGSGPGGEVLESESVVVFEQGKPRCI*
back to top