Sh_005H13_contig-1_p000110

Overview
NameSh_005H13_contig-1_p000110
Unique NameSh_005H13_contig-1_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length180
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005H13_contig-1contigSh_005H13_contig-1:81235..82502
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005H13_contig-1_t000110Sh_005H13_contig-1_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005H13_contig-1_p000110 ID=Sh_005H13_contig-1_p000110|Name=Sh_005H13_contig-1_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=180bp
MQPRSCGVQGYKKFVEDMEELPKTKVLEVKGLSTKQHLGPAMLHLLKKFT
GLTKLKIDLLPVNSWKSLSSHDCKCLEPGSIVFQTGRPARHGHGHGEARH
GEARVARRPAVPCLIVPPCPNLGPGTALSGHNRVVPCHQARQHISAHAGP
GTKPQLHYQKSSITDLYHSSHLHIIKLSC*
back to top