Sh_005H13_contig-1_p000130

Overview
NameSh_005H13_contig-1_p000130
Unique NameSh_005H13_contig-1_p000130
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length75
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005H13_contig-1contigSh_005H13_contig-1:85966..86190
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005H13_contig-1_t000130Sh_005H13_contig-1_t000130R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005H13_contig-1_p000130 ID=Sh_005H13_contig-1_p000130|Name=Sh_005H13_contig-1_p000130|organism=R570 Sugarcane cultivar|type=polypeptide|length=75bp
MLSRAVPVSAHRARPIWKTMPGSWKTDGVTLDSLEELEISNFTGAEDDTE
FLKLLFGARSNSVGWPSTQEKTFL*
back to top