Sh_005H13_contig-1_p000140

Overview
NameSh_005H13_contig-1_p000140
Unique NameSh_005H13_contig-1_p000140
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length819
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005H13_contig-1contigSh_005H13_contig-1:89100..93103
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR024171
InterProIPR001245
InterProIPR001480
InterProIPR003609
InterProIPR011009
InterProIPR000719
InterProIPR021820
InterProIPR008271
InterProIPR000858
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005H13_contig-1_t000140Sh_005H13_contig-1_t000140R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005H13_contig-1_p000140 ID=Sh_005H13_contig-1_p000140|Name=Sh_005H13_contig-1_p000140|organism=R570 Sugarcane cultivar|type=polypeptide|length=819bp
MAAGARPPLALLLPLFVTFFSSSPASASAADTLTANSSLSDGQTLVSAAR
VFELGFFTPASSTARFLGIWYMGLAPQTVVWVANREAPITGTAASLAINA
TGSLALADPSSGQVFWSSPPPSNVSSTGAAAPVAAQLLDSGNFVLRGAGG
AGAVLWQSFDYPSDTLLPGMKLGWDLTTGLDRHLTTWRSPGDPSPGDYTF
GFDLHGVPEGFIRRNGTVPVYRNGPWNGLQFSGEPEMEPNNSNFQFEFVD
NASEVYYTFLVDGGNGGGNGSGGGGVVSRFVLNQSSVQRYVWPPGGQGWS
LYWSLPRDQCDSYGHCGAFGVCDTSSGSPACACVRGFTPASPRDWELRDS
SAGCRRVTPLNCTRDGFLQLRGVKLPDTTNATEDAAITVGQCRQRCLANC
SCLAYAASNIKGGDSGCIIWSSLLIDIRHFPSGGQDLFVRLAASDLRRFQ
SAQRFNSFDSSVLLTAVQLQDRSKEDEAGQSSDLNVTLFDMDAIAFSTDN
FAAWNKLGEGGFGPVYKGQLEGGQTVAVKRLSKYSTQGLGEFKNEVMLIA
KLQHVSLVRLLGCCVHGEERMLVYEYMENKSLDNFIFDKNRSAQLHWSKR
FDIILGIARGLLYLHQDSRYKVIHRDLKAGNILLDKDMNPKISDFGVARI
FGDDTDSHTRKVVGTYGYMSPEYAMDGVFSVKSDVFSFGVLVLEIVSSRK
NRGMYSSGEQTSLLSQAWKLWREGNALALLDEAVARAGTHRSSEVLRCVQ
VALLCVQERPDDRPHMAAVFLALGNPGAVLPQPRHPGYCSDRGSASTDGE
WSSTCTVNDVTVTIVEGR*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0004674protein serine/threonine kinase activity
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation
GO:0048544recognition of pollen