Sh_005I10_p000030

Overview
NameSh_005I10_p000030
Unique NameSh_005I10_p000030
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length113
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005I10contigSh_005I10:21347..21999
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005I10_t000030Sh_005I10_t000030R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005I10_p000030 ID=Sh_005I10_p000030|Name=Sh_005I10_p000030|organism=R570 Sugarcane cultivar|type=polypeptide|length=113bp
MSAPVAQAVVALALAAILSTPAPQADTFSNVPPTLSGGDGKQERIKHPRS
AKALQCTAKCVGTCIRGGGGAPGEGPLNVRRPLVVFKDGFRSRQYWWCSD
ICNRIKDGQDGP*
back to top