Sh_005I10_p000040

Overview
NameSh_005I10_p000040
Unique NameSh_005I10_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length531
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005I10contigSh_005I10:23582..26515
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR025757
InterProIPR006869
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005I10_t000040Sh_005I10_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005I10_p000040 ID=Sh_005I10_p000040|Name=Sh_005I10_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=531bp
MPLPLAKARWGFSPQPEPQPARSSCRSQLEQDVSHRSPLPPPMPTLTHAL
TWNARAPAQVKRLRKALQEETALHAVLEGALGRAAVTLADMAYLPTNAQE
LLSNICILETAVTKLEEEMVSLHFQLIQERNERRLVEYRLKHLPPPPSAC
SCHSGKLGPDDTTGEKCSSQGVEVYPRAVLHEQAVKLQRQISVKGFADPN
QLSEDINQQSIPSPTGNYSISAFWSLSEPSSISSWVQSPQVDLNYNNNLL
ASETVFDPYKAREKLSWADIGGYSAAAEVSWMSVGKKQLEYAAESLRKFR
LFLEQLAEINPIHLNDDARLAFWINLYNALMMHAYLAYGVPRSDMKLFSL
MQKAAYTIGGHSFSAAFIEYVILKMKPPSHRPQMALLLALQKIKVPEEQK
NSAIAAPEPLLTFALSCGMYSSPGVKIYTANNVREELQDAQRDFIRASVG
VSRKGKLLVPKILHCFARGFVDDNSFPIWISHFLPQQQATFVDHCVSQRR
QSLLGTRTFGIIPFDSRFRYLFLPDMGSLN*
back to top