Sh_005K04_p000010

Overview
NameSh_005K04_p000010
Unique NameSh_005K04_p000010
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length328
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005K04contigSh_005K04:1..1110
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR000217
InterProIPR002452
InterProIPR018316
InterProIPR003008
InterProIPR008280
InterProIPR017975
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005K04_t000010Sh_005K04_t000010R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005K04_p000010 ID=Sh_005K04_p000010|Name=Sh_005K04_p000010|organism=R570 Sugarcane cultivar|type=polypeptide|length=328bp
KLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVEYGKKSKLGFTVYP
SPQVSTSVVEPYNSVLSTHSLLEHTDVSILLDNEAIYDICRRSLDIERPN
YSNLNRLVSQVISSLTASLRFDGALNVDVNEFQTNLVPYPRIHFMLSSYA
PVISSAKAFHEQLSVAEITSSAFEPASMMVKCDPRHGKYMACCLMYRGDV
VPKDVNAAVALIKTKRTIQFVDWCPTGFKCGINYQAPTVVPGADLAKVQR
AVCMISNSTSVVEVFSRINSKFDLMYAKRAFVHWYVGEGMEEGEFSEARE
DLAALEKDYEEVAAEGGGDDGEEDEEY*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Biological Process
TermDefinition
GO:0007017microtubule-based process
Vocabulary: Cellular Component
TermDefinition
GO:0005874microtubule
Vocabulary: Molecular Function
TermDefinition
GO:0005200structural constituent of cytoskeleton
GO:0005525GTP binding
GO:0003924GTPase activity