Sh_005K04_p000020

Overview
NameSh_005K04_p000020
Unique NameSh_005K04_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length224
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005K04contigSh_005K04:7190..9790
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC1.6.5.3
EC1.6.99.3
EC1.6.99.5
InterProIPR017896
InterProIPR010226
InterProIPR017900
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005K04_t000020Sh_005K04_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005K04_p000020 ID=Sh_005K04_p000020|Name=Sh_005K04_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=224bp
MAALLARQAAQALRARQMAQLGPAASAMQGHLRTYMNAGIPKRFKEDEEK
EQLAKDVAKDWNAVFERSINTLFLTEMVRGLMLTLKYFFDRNVTINYPFE
KGPLSPRFRGEHALRRYESGEERCIACKLCEAICPAQAITIEAEEREDGS
RRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFATETHEELLYDKEK
LLENGDRWETEIAENLRSESLYR*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016651oxidoreductase activity, acting on NAD(P)H
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process
Vocabulary: Cellular Component
TermDefinition
GO:0016020membrane