Sh_005K04_p000060

Overview
NameSh_005K04_p000060
Unique NameSh_005K04_p000060
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length210
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005K04contigSh_005K04:43583..57716
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR007213
InterProIPR029063
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005K04_t000060Sh_005K04_t000060R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005K04_p000060 ID=Sh_005K04_p000060|Name=Sh_005K04_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=210bp
MAQLAPEGVRALHARVEAEWGPVLQSACQTAAARALWGRAVRDPAAGVLA
GERYLRGLHDKMRRDERAGAREVHGVMIAVRTLWFDARIEAAVAALGGDP
QVVILGAGMDARAYRLSCLKECTGSCQHTRWRLDNKAAELWVTLTQIGDP
EAHFGLLSHPENLFDKLRKLPRSMEKNPADGTPCCRLYFVEASASPDNQT
MCPLDHYLE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0008168methyltransferase activity
Vocabulary: Biological Process
TermDefinition
GO:0032259methylation