Sh_005K04_p000090

Overview
NameSh_005K04_p000090
Unique NameSh_005K04_p000090
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length652
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005K04contigSh_005K04:66881..70072
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC4.1.3.44
InterProIPR007197
InterProIPR034556
InterProIPR001094
InterProIPR008254
InterProIPR023993
InterProIPR029039
InterProIPR013785
InterProIPR013917
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005K04_t000090Sh_005K04_t000090R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005K04_p000090 ID=Sh_005K04_p000090|Name=Sh_005K04_p000090|organism=R570 Sugarcane cultivar|type=polypeptide|length=652bp
MPPFPAASTASTTSHLALLVLLSSSSLFFLYKSLRLRRKPSPPPARTAAP
TLLYASATGTSKTLAERLSARLTADAGFPVRATDAATFDPDDLPSVPLLL
IVIPTHDGGAPPPSAAFLSRWLEESAADFRAGALLLSGLSFSVFGVGSRA
YGETFNAAARSFSRWLRALGAVEVVPLGEGDMDGGDLEAVFEEWSRRVLR
VVKGEEVGYGANEKSNGLDELELEGEDWDDNDEEEMVDAEVDMEDIAGKA
PARRKNGNLEGVPANGVQNGVKDMVTPIIRTSLEKQGYKIIGSHSGVKIC
RWTKSQLRGRGGCYKHSFYGIESHRCMEATPSLACANKCVFCWRHHTNPV
GKSWKWKMDDPLDIVNAAIDQHTKMVKQMKGVPGVKPEKLEEGLSPRHCA
LSLVGEPIMYPEINALVDELHRRHISTFLVTNAQFPEKIKALKPITQLYV
SVDAATKESLKAVDRPLFTDFWERFLDSLKSLHEKDQRTVYRLTLVKGWN
AEEIDAYAKLLDLGQPDFIEIKGVTYCGSSATSKLTMENVPWHSDVKEFS
EVLASKSGGVYEVACEHAHSCCVLLAKVDKFKINGKWHTWIDYDRFHELV
TCGKPFKSRDYMAMTPSWAAYGAEEGGFDPDQSRFKKERRHGTAAHKSLS
S*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003824catalytic activity
GO:0051536iron-sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
GO:0010181FMN binding
GO:0016829lyase activity
Vocabulary: Biological Process
TermDefinition
GO:0008033tRNA processing
GO:0055114oxidation-reduction process