Sh_005K04_p000140

Overview
NameSh_005K04_p000140
Unique NameSh_005K04_p000140
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length949
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005K04contigSh_005K04:120417..123907
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR032795
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005K04_t000140Sh_005K04_t000140R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005K04_p000140 ID=Sh_005K04_p000140|Name=Sh_005K04_p000140|organism=R570 Sugarcane cultivar|type=polypeptide|length=949bp
MAKVPDLGSDFAQKLLRDLRRRRERLGFESSAAPRARDAYSNAQKPPQVH
KPQQAAPRVAATNISRRQGNSSSIARPGTPRRHDAPAVAHSHAIVPFQGG
AGGKQTAPAASAGCVDVQMALALALSNSGKIQNVHLVERQGAGGGSVFFG
EPGRTGTASQARHHLLAPGAHVGKVAIGVQKLNDILVAYSGGAAGARRGS
VEIGKQLLRGAMDLEESLSMLMMLQDASDYMEMGNSGNGGKVLLLEGKDS
WKSSAAPRSTTSASARLVEIVDGDSEETEQADDAKSPSDAFLQIVPHGMS
QSYRPNHISSLQFSSVKNNCKSNATSGEKDGSKVRMPSLIAKLMGLENLP
SAKTVAERKGTERFVKPEAVPRKSTAANVMAGTLPIRIIASERMPSRGQV
KNFQTREWNISLTKSEEPVLSSRFSHLTVDKQTRQTMRQMLSKQEGTERR
VSVNQVVDLKIVHQDTKLTEDTNQQKTTVSAGRNMNFLQRFRKNGKNKPA
TEEKTIVEENKQKLGKKQTTSIKQREREVKSRKAREKFNQENLANPGNKA
QGKNGKAAKTDQMRKQAQSKPSDKQIVEKKVKNYRQMKSETDIQSLEQKR
SLKSEPTHKKEKLELIILTELQNGEGTKVDDTRNRKPSDNTPGDDGLWEQ
SAAEMEGSSTTREALSYQSEKELTEEINEPTTAGAQTTSETIAETNDDRV
NHTVSETIQTLETFPEGEQQQQQLQQMKEVNDQSINGLDHIVMPSNPNDF
KNHKMDVVSCDSFTENQLLLAEMLLKDPYLLETAKAITGFHVPVSVVQVN
TGKWLDKGNKVLSDIGREVIRRKGKRTEAIVDVSVTRTANLKLQTLDDLI
RELDGDIQSLPIPKKIQQQSGHSTAENLKMVLRSDVENMHSDANSVWDFG
WNRVWDLPIEKNEVVKDLEKNILGGIITDVARELIDVSLRHQCCACES*
back to top