Sh_005M04_p000020

Overview
NameSh_005M04_p000020
Unique NameSh_005M04_p000020
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length361
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005M04contigSh_005M04:40860..43929
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR029069
InterProIPR002864
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005M04_t000020Sh_005M04_t000020R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005M04_p000020 ID=Sh_005M04_p000020|Name=Sh_005M04_p000020|organism=R570 Sugarcane cultivar|type=polypeptide|length=361bp
MAWTVSCSRVFVVRSLAELSVPVLPLLPATEGDGDVGGEERSRQNIPTEK
QTVDPFRQALIVEGGVRYQQTLVVRSYEVGPDKTATLETVLNLLQETALN
HVWMSGLLGDGFGATHGMIRNNLIWVVSRMHVQVDQYPIWGEVLDIDTWV
GSSGKNGMRRDWLIRGRNSGDVFVRATSTWVMMNKVTRRLSKMPEEVRGE
IAPWFIDRHAIQDEATEKIVKLDSNAMYIDSDLKPKRSDLDMNHHVNNVK
YVRWMLETLPDHFLQQNQLSSITLEYRKECGSSDVVQSICQPDEDSIPPQ
ENVSMVIGPSLSPEIISGHHSLAGALQQSPMKYTHLLQLKAGDKYEEIVR
GRTTWKKKNI*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0016790thiolester hydrolase activity
Vocabulary: Biological Process
TermDefinition
GO:0006633fatty acid biosynthetic process