Sh_005M05_p000040

Overview
NameSh_005M05_p000040
Unique NameSh_005M05_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length506
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005M05contigSh_005M05:30593..32441
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR025287
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005M05_t000040Sh_005M05_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005M05_p000040 ID=Sh_005M05_p000040|Name=Sh_005M05_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=506bp
MCSTAVLLARTCLVLIMCLAAVVQPPPTKVHAAGTRDGLLAVPTNASLAH
CPSHCGNVEVSYPFGIGPGCFRRGFELTCDNTTGSPRLLFLGNSSTQVTS
IYVDSNIVWASAVGYNITMGLGVDVVYTQSWEAPTGVSIGYANYLYVVGC
GVDAYMFGDNTTDLIGSCMSICTDNRETMVRPNAACGGFGCCTIWSLTTG
RQTFTLKLGRRSSTIAPLDEALPSVKVIFSRQYEFVIDDLYASWVNTTNV
RDMVLDIAITDQPSCAIAKSPVNKSTYACNSESICNDLPLSRGGYNCLCP
DQTEGNPYVVDGCIQQDYNPRVLKENCTRFCGNVTIPFPFGIEEGCFGND
RLRLNCTSNSTTVLDRGYAQYRVTSLSLDDGFLTVTNYNDNHCQSFSRYY
SYRDDLLYCSDEDIMIKWVVANLTCQEARLNNATYACISDNSFCEDVMQE
ETRFGYLCKCSDGFHGNPYLKNNCTGHISLQNLFALSFLVSLILTYRIIV
LLHRL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0030247polysaccharide binding