Sh_005M05_p000070

Overview
NameSh_005M05_p000070
Unique NameSh_005M05_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length202
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005M05contigSh_005M05:45028..50649
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR018097
InterProIPR001881
InterProIPR009030
InterProIPR000719
InterProIPR017441
InterProIPR011009
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005M05_t000070Sh_005M05_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005M05_p000070 ID=Sh_005M05_p000070|Name=Sh_005M05_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=202bp
MLRMRASVTIVSVKRSCEGKRMMDTAAKCSDGFQGNPYLQNNCTDIDECS
IPNKCNGICHNFDGGFNCTSCSHGKEYDTKKQKCVMSTKQRNLILGIAIG
LACGLGFISFTLGAIVLIHKWKKDIQRRIRRAYFKKNQGLLLEQLISNES
VTTKTKIFTLEELEEATNNFDTTRVLGHGGHGTVYKGILSDQRVVAIKNL
K*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005509calcium ion binding
GO:0004672protein kinase activity
GO:0005524ATP binding
Vocabulary: Biological Process
TermDefinition
GO:0006468protein phosphorylation