Sh_005M20_p000070

Overview
NameSh_005M20_p000070
Unique NameSh_005M20_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length190
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005M20contigSh_005M20:71272..71841
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR001471
InterProIPR017392
InterProIPR016177
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005M20_t000070Sh_005M20_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005M20_p000070 ID=Sh_005M20_p000070|Name=Sh_005M20_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=190bp
MCDAAAVAVAVPRYRGVRKRPWGRFAAEIRDPAKRARVWLGTFDSAEAAA
RAYDVAARALRGPLARTNFPAHLPALTSRPPAAVAAPTCSSSSTVESSSG
PRAGVPRAAAAAVHRRRAPTKPRPLRQAAPTDADCHSDCASSASVVDDGD
DASTVRSLSCPRPTLDLNLPAPLELDDGHDLGLCTDLRL*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: Biological Process
TermDefinition
GO:0006355regulation of transcription, DNA-templated