Sh_005M20_p000080

Overview
NameSh_005M20_p000080
Unique NameSh_005M20_p000080
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length316
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005M20contigSh_005M20:87234..88771
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR027417
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_005M20_t000080Sh_005M20_t000080R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_005M20_p000080 ID=Sh_005M20_p000080|Name=Sh_005M20_p000080|organism=R570 Sugarcane cultivar|type=polypeptide|length=316bp
MGAWLPQSGPDERCIPGNTIAVQADMPYSGLSSFGTAFFIKLLEHVTFVD
TPGVLSGEKQRTQRSYDFTGVTSWFAAKCDLILLLFDPHKLDISDEFKRV
IGSLRGHDDKIRIVLNKADQVDAQQASIPAYRHALFSLMRVYGALLWSLG
KVLNTPEVMRVYIGSFNDKPIRETAAGPLGMELFQKEQDDLLSDLNDIPK
KACDRRINEFVKRARAAKVHAHIISHLKKEMPALMGKAKAQQKLLDGLDE
HFAKVQKELHLPPGDFPSVEEYRELLSAYNFDRFEKLRPKMVQGVDDMLA
YDIPDLLKKFRNPYD*
back to top