Sh_005M20_t000060

Overview
NameSh_005M20_t000060
Unique NameSh_005M20_t000060
TypemRNA
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length804
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_005M20contigSh_005M20:64503..69259
Analyses
This mRNA is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Properties
Property NameValue
Notesimilar to H0818H01.3 protein
Relationships

This mRNA is a part of the following gene feature(s):

Feature NameUnique NameSpeciesType
Sh_005M20_g000060Sh_005M20_g000060R570 Sugarcane cultivargene


The following polypeptide feature(s) derives from this mRNA:

Feature NameUnique NameSpeciesType
Sh_005M20_p000060Sh_005M20_p000060R570 Sugarcane cultivarpolypeptide


Sequences
The following sequences are available for this feature:

mRNA sequence

>Sh_005M20_t000060 ID=Sh_005M20_t000060|Name=Sh_005M20_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=804bp
ATGGTGGTGCGGCGGCTGGGCGGCGCGGGGCGCGCGCTGCTCACGCTCCC
CAACATCCGGAGGCGGGCGTCCAACTCCTGGGCCGCCGTCTGCGATACCT
TCTTCTCCACCAAGCAAGTGTTCGAGAACCACCGCATCGTCTTCACAGTC
GGCACCTCCATCGCCTCCGTCCTCACGGCTTGGGCCGGCTATTCACTTCG
CCAGGTGCATCAATCAAGGATTGAAAGGAGGCTTGAGTCAATTGAATCAT
CTCTGAAGGGAAACCACAAAGTTGAACATGAAGAGATAAAAAAGATCGTC
ACTTCCAGCAATATTAGCGCTCCAGCCTGTGTAGCCACGGCGATGACCAC
AATGGTTGTTGGGTACACGCTGGGATGGCGAGGCGGTGCTTGGTATGCTC
GAAGGGCCTTGAGAAGAGAGCAACAAAAGATGATGATGGGTCACATGAAG
TCACATAACAGATGGCACTGGCGGCCCTTCAACAGACTCAGAAACAGGCT
TAGGAATAGCAGGAGGAGGCTCCGCGTGGATGCGATCAGGACGCAGCGGG
AGAAGCAAGGGACGGACGGAGTCGGAGCGGACGACCCCATGGTTCCCTCC
TCGGACGAGAGCGACTGGGTGGTCAGGCTCGAGCAGTCGTTCAACATTTT
CGCCACGGATTCGGTGATTATGGTACTCAAGGGCGTGTACCGTGATCGGT
ACTACGCCAGGTTCTTTGCCAGGCCAGGGTGCCGTATTTCGCGTTCATAT
CGGTGCTTCACATGTATTCGACCTTTGGCTGGTGGAGACGAGCTGATTAT
ATAA
back to top

protein sequence of Sh_005M20_p000060

>Sh_005M20_p000060 ID=Sh_005M20_p000060|Name=Sh_005M20_p000060|organism=R570 Sugarcane cultivar|type=polypeptide|length=268bp
MVVRRLGGAGRALLTLPNIRRRASNSWAAVCDTFFSTKQVFENHRIVFTV
GTSIASVLTAWAGYSLRQVHQSRIERRLESIESSLKGNHKVEHEEIKKIV
TSSNISAPACVATAMTTMVVGYTLGWRGGAWYARRALRREQQKMMMGHMK
SHNRWHWRPFNRLRNRLRNSRRRLRVDAIRTQREKQGTDGVGADDPMVPS
SDESDWVVRLEQSFNIFATDSVIMVLKGVYRDRYYARFFARPGCRISRSY
RCFTCIRPLAGGDELII*
back to top

mRNA from alignment at Sh_005M20:64503..69259-

Legend: exonpolypeptideCDS
Hold the cursor over a type above to highlight its positions in the sequence below.
>Sh_005M20_t000060 ID=Sh_005M20_t000060|Name=Sh_005M20_t000060|organism=R570 Sugarcane cultivar|type=mRNA|length=4757bp|location=Sequence derived from alignment at Sh_005M20:64503..69259- (R570 Sugarcane cultivar)
GGCGCCCGTTCGTTGCGTATTCCGCAAGTTGGTCGGCCTCCCTCCCTCCG CCGTGGGAGGGGAAAGCGGAGGAGGTAGAGGAAGAGGAGCCAAGCGGTTA AGCCAGCTCGGCCGCTCGCCTCCCACCCAAACCCCCCCGAAAATACTCGA ATCCCCACCCAAGCAACATCCCGAAAAAGGCGTGAAGCGCCCGAGGTCGG GGGCCGATGGTGGTGCGGCGGCTGGGCGGCGCGGGGCGCGCGCTGCTCAC GCTCCCCAACATCCGGAGGCGGGCGTCCAACTCCTGGGCCGCCGTCTGCG ATACCTTCTTCTCCACCAAGGTGACGACTGGCGACCTAGCCCCCCTCCCT AATGCAGTGCGATCTTGCTTGATTCGCTGACGCGTGCGCGTGCGCTCTTC CGATGGCCCGCAGCAAGTGTTCGAGAACCACCGCATCGTCTTCACAGTCG GCACCTCCATCGCCTCCGTCCTCACGGCTTGGGCCGGTACGCTCCTCCCT GCTCTGGCAGATGAGCTGTTGCTCTAGATTTCAGTATTGACCATGGTTTG GTGGGTGATGTGTGAATAATCAACGGCCTGGAAGTTCAGCCTGATTCATC AGGCTGGGTTTCCCAGTCACTTTAGGCTGTAGTTGTGGGAGGTACTGCTG CAACCGTGCAGCTTATGTGCTGCTACAGATTTGTTACGCATAGTGATTGA CTTTGATAGGGGTTAGGGAATGACTAGATTAGAACTGTACAGCAATGGTT TCAGTGTCCAGTGTGTCTGGGATGGAAGCTTGGACTTTGTATCCCATTTT CTTAGGACCATATGAGTTAGGCTTGGAAAAACATAGTTTACCTTTGGTGT TCGATTGTTTGCTGATTCCCCAATTTAATTTGCATGAAGTGATTATTCTA AACTCATGTTGATCAGTCCAATTATATTTTGTTAAATTTGAAGTCACATT CACTTGGGTTTCCAACTGGTAGTTTCTCGTCATGTACAACCGTTTGGATT AACAGAAAATAATGTGACTAATGTCCATTTTTTAATTAAGCATTTGTAAT GTACTGAATGTTTACTTATGTTTCTTAGAATATCTTCATTGGATGGATTC ACAATATTTACAATGTGAATTTTCTCACTATAGGCTATTCACTTCGCCAG GTGCATCAATCAAGGATTGAAAGGAGGCTTGAGTCAATTGAATCATCTGT AAGTAATTTAGAAGAAATACTGTTTTCTTTGGTGAAGCGAGCTGTTCTCT CCTTTGGGCTCTGTTTATAAGCTGGTAACCCCAGCAGGTGGTGTGAGCAT TAAGACGCTGTTGTGTAATCTCTTAGCCTCTGACAAAAAAAGGGAAAAAA ATACGGGTTTTCTTAAAGATGCAGGAGTGTTGTGTCTTTTAGTCAAAAAG AGATAACTGGTCTGAAAACACACACTTTCGAAACACAAACTCTCACACAA AAGCACTGACACACAAACGCACACCCCCAGACAGACAGTAAGATCACCAC ACAGAAGAAATACTGTCAAAGTTTTTTTAGTTACTCTTTGAACACAGAGT TGTATCCTCTACACCTGTTTCTGTTTGGGCCATTCTCATTTCTCACTTCT CAGCTTGACCTACATATGCAAAGCTGACAGCAAAGCAAGTTTGGACTGTT CCACTGTAGGCTTAAAATTTCAGGGCATATGAGATTAGAAACATGTGTGT GGTGCTATTTTGTTTCCTGAGCAACATTTTTTTTGTTGAAACAAACATGC AGGAAAACCGCCTATTATATTACAAGGAAAATTGGTTTGGGGGACTTTTT TTTTCTGATTTTTTGCAGTAGGATGCTGTTAATTTTCCCCTTGTCTGTAG GACACTAGTGACAAGAAGTTTTTGCGTGTGTCCTATAGGCAGGGCACATT TGTTCTTGTCCTGTAGACAAATTTTCCATATTAGAAAGAAAGAGCAAAAA TGTCCTGTAGACAAATTTCCCATACTAGAAAGGAAGAGCAAAACACTGTC TGTGAAGGGAACTACCACAGATTACAATACAACCTAGTGTTCCAACAGAA CATACCTTGTGCTGTTGACAACAAGATTAAAGTGTTCTCTCGCTGTCCCT TTCATCTGTATCTATTTCAATATGTTGCTTATTTTTATTTTTATGGTGCA CTCTGACGTTGGAGATACACTCCTTAACCCAGCCAAAAAAACATGATGCT TTAGGTTTTTATATTGTACCACGTTGCCTACAAGTTTTCGAATGGTTGGA TCGTCTGCTTTCCTTGTCCCTTTCTATTTTCTTTTTGTTCTTTTTTCACG TGTTGACTGCTAGACATATTTATTTATACCATTTCTTGATCTGTTACCAG CTGAAGGGAAACCACAAAGTTGAACATGAAGAGATAAAAAAGATCGTCAC TTCCAGCAATATTAGCGCTCCAGCCTGTGTAGCCACGGCGATGACCACAA TGGTTGTTGGGTATGTTCTTGCTGTTGATATTCAACTTTGGTTTTCTACT TTGCTCTTATCCACTTTGATAGTACCGCTCTTTGAATTTATGTAATTCAT TTTATGACCTGGCATGATACTTACTTTCTAGATAAGGCTATAATGTCCTA AGGCTTAATTTAAGCTTAAATCCATGCATATGTTCTATACTTGACATGAC TGTGGTCCACATTGACCATCATGCATCAAATTGGTACTTGATTCATTGAT CTATGTGGTTACTGGCTTAGGATGGGTAGATGTTGAAGGAGTACATTTAC TACCAGGCTTGCTTTTGAGTTTTGAACCTTTTCCCACTGCTCAGAACAGC ATCAAGTATTATGACTTGAGTGTACACACTGCCGACCATTTTGGACTTTG GCATCATTGGGACCGGACCAGTTTGGACTTAAAGATCTTATTTTAGCTAA GATGTTGCCATGTTATGTATATAGTGATAGTCAAACTTGAAATTCACTGG TCTGATGTTAAATTGCACCTGCCATGCTTCAGCTTCCATTAGTGGTATGG ATATGGAACCATTTCCCACATGTGCTGCTGGTGGCAACTTAATTTCCACC ATCATAGTATCTTGCAACCTAAGCAGTTCCACTTTGCTCATGCATTGTCA TTGGGGGATCTATTACAATTCCAAGCTCCAATCATCTGGTGAAAATTTAC ACGAGTAACAAATGACAGCCTGTCTGTTTGCATCAACCTAAGTGTGTTAT CTTGTGGAATTTCCAGGTACACGCTGGGATGGCGAGGCGGTGCTTGGTAT GCTCGAAGGGCCTTGAGAAGAGAGCAACAAAAGATGATGATGGGTCACAT GAAGTCACATAACAGATGGCACTGGCGGCCCTTCAACAGACTCAGAAACA GGCTTAGGAATAGCAGGTTAGCCTCCAAGAACAAGAGCGCCGACGCCCAT CCGTCGGTGGGTCAAAGCAGCGAGGCCCCCTCAACCTCTGCGAACGTTAG CGGTGCTTCTCAGCCGGCAGCGGGCAGTGCATGAACTATATATGCATACT ACATGGACTAAGATGTTGAACTTGATGGACTAGGATGCATGAACTATATA TCCACTAGCGAGTAGTAGTGAAAAAGACATCCACTAGAGTTGGAAACTCA GCACTAGCTAGCGATCAATCAGGCGCTGCAGTGGTCGCGAGCACTGCCGT GCTGCCCGCCGCGGTGCCGCCCCCCACGCAGCAACCGTAGGCCGCGACAA GCACGGCAAACAGCTGCTGACACCCCCATTTCCCACACGGAACCACCAGG CGCCAGCCAGCGTCATGGCGGTGGCCTCGACGTCGCCCCTGTCCGCCACG GCCCCCTCGCCGCCCGCTCCCGCATTCGGCTTCCGCGCTCTCCGCTACCG CCTCGGCCGCGCCAGCTCTAGCCCGGCTGGTCCATCTGTCTCCGCCATAC TAATAACCCGGCCTGCTGTGCAGGAGGAGGCTCCGCGTGGATGCGATCAG GACGCAGCGGGAGAAGCAAGGGACGGACGGAGTCGGAGCGGACGACCCCA TGGTTCCCTCCTCGGACGAGAGCGACTGGGTGGTCAGGCTCGAGCAGTCG TTCAACATTTTCGCCACGGTGATTCTTCAGTAGCCCACCAGATTCCCAGC ACAATGCGTCCTGATTTCTTCACCCCTGCAAAATCCTGTACCCATACGTC TCCATATCTTACTAGTGTGCTATTCCTTTCCTTTTTTCGCGATCGGGCCA TCCTTTCCGCAGGATTCGGTGATTATGGTACTCAAGGGCGTGTACCGTGA TCGGTACTACGCCAGGTTCTTTGCCAGGCCAGGGTGCCGTATTTCGGTGA GGGCTCCGTTTTCTCATATGCTTGCCTGAAAAAGGCTCCGTTTCTGCCGT GCCGTTGTGGTGTGCTTTTTTTTTTTTTTTGGACTCTGCTTGGTTATGAA CAGCGTTCATATCGGTGCTTCACATGTATTCGACCTTTGGCTGGTGGAGA CGAGCTGATTATATAAAGGTTCACTTTGCGCAGAGCTGGAACGAGTTCCA TCACCTCTTGATCATGGAAGTATGTCTCCATCTTCCCTTTCCAGTAAAAT TCATGTGCGCGACATCCACCTTTCAGTGCTATTATGTCACCACGACTTAA TTCTATTCTGTTGGTTTGCCTATTTTGTTTTCCTTATTAATTATCACTTC AGTTTCTTTACATGAATTCAACCTACTTATGGATTCATCCCTTGGCTCAT ATCAGGAATTGGGCGGCAACTCTTTATGGATTGACTGTTTCCTTGCTCGG TTTATGG
back to top

Coding sequence (CDS) from alignment at Sh_005M20:64503..69259-

>Sh_005M20_t000060 ID=Sh_005M20_t000060|Name=Sh_005M20_t000060|organism=R570 Sugarcane cultivar|type=CDS|length=804bp|location=Sequence derived from alignment at Sh_005M20:64503..69259- (R570 Sugarcane cultivar)
ATGGTGGTGCGGCGGCTGGGCGGCGCGGGGCGCGCGCTGCTCACGCTCCC
CAACATCCGGAGGCGGGCGTCCAACTCCTGGGCCGCCGTCTGCGATACCT
TCTTCTCCACCAAGCAAGTGTTCGAGAACCACCGCATCGTCTTCACAGTC
GGCACCTCCATCGCCTCCGTCCTCACGGCTTGGGCCGGCTATTCACTTCG
CCAGGTGCATCAATCAAGGATTGAAAGGAGGCTTGAGTCAATTGAATCAT
CTCTGAAGGGAAACCACAAAGTTGAACATGAAGAGATAAAAAAGATCGTC
ACTTCCAGCAATATTAGCGCTCCAGCCTGTGTAGCCACGGCGATGACCAC
AATGGTTGTTGGGTACACGCTGGGATGGCGAGGCGGTGCTTGGTATGCTC
GAAGGGCCTTGAGAAGAGAGCAACAAAAGATGATGATGGGTCACATGAAG
TCACATAACAGATGGCACTGGCGGCCCTTCAACAGACTCAGAAACAGGCT
TAGGAATAGCAGGAGGAGGCTCCGCGTGGATGCGATCAGGACGCAGCGGG
AGAAGCAAGGGACGGACGGAGTCGGAGCGGACGACCCCATGGTTCCCTCC
TCGGACGAGAGCGACTGGGTGGTCAGGCTCGAGCAGTCGTTCAACATTTT
CGCCACGGATTCGGTGATTATGGTACTCAAGGGCGTGTACCGTGATCGGT
ACTACGCCAGGTTCTTTGCCAGGCCAGGGTGCCGTATTTCGCGTTCATAT
CGGTGCTTCACATGTATTCGACCTTTGGCTGGTGGAGACGAGCTGATTAT
ATAA
back to top