Sh_006C18_p000040

Overview
NameSh_006C18_p000040
Unique NameSh_006C18_p000040
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length101
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_006C18contigSh_006C18:45538..46102
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_006C18_t000040Sh_006C18_t000040R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_006C18_p000040 ID=Sh_006C18_p000040|Name=Sh_006C18_p000040|organism=R570 Sugarcane cultivar|type=polypeptide|length=101bp
MSYCRSVSSISQYLWSHYSCLLLHVRSHYADCNSCSFMSRSVGSFALALP
VYRLSSHVRLSSAEPAAEFQQHEATTNGADSSIEQQEDGDLGFMLKGLFG
*
back to top