Sh_006C18_p000050

Overview
NameSh_006C18_p000050
Unique NameSh_006C18_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length141
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_006C18contigSh_006C18:48689..49111
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR010920
InterProIPR001163
InterProIPR034110
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_006C18_t000050Sh_006C18_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_006C18_p000050 ID=Sh_006C18_p000050|Name=Sh_006C18_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=141bp
MACSSTRGGIVLGTMEGEGPPGPSQAIPVSGDAYCNSSTAPVDAAGSSSS
PAVAKLRKLLFRRMLIGVNDGRYFHGLFHCIDKQGNIILQDAVEYRSAAR
HCSPPTEQRCLGLILIPAACRSSCQVDCSVEEKMSLLCLD*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
TermDefinition
GO:0031417NatC complex