Sh_006C18_p000070

Overview
NameSh_006C18_p000070
Unique NameSh_006C18_p000070
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length343
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_006C18contigSh_006C18:54905..57381
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC1.1.1.31
EC1.1.1.373
InterProIPR029154
InterProIPR006115
InterProIPR002204
InterProIPR008927
InterProIPR015815
InterProIPR011548
InterProIPR016040
InterProIPR013328
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_006C18_t000070Sh_006C18_t000070R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_006C18_p000070 ID=Sh_006C18_p000070|Name=Sh_006C18_p000070|organism=R570 Sugarcane cultivar|type=polypeptide|length=343bp
MAGLGWRVGSKLQRWGWSCLRGFSSAAVPSQLENVGFIGLGNMGSHMARN
LITAGYKVTVHDINENSMKKFSDDGIPTKQSPLEVSESSDVIITMLPSST
HVLDVYNGPNGLLFGGERLGPWLYIDSSTVDPQTSRKISTAISRCHLKEK
KGYAESPMILDAPVSGGVPAAEAGKLTFMVGGLEEAYLAAKPLLLAMGKK
AIYCGGAGNGSAAKICNNMAMAISMLGVSEAFALGQNLGIKATTLTDIFN
CSTARCWSSDTYNPVPGVMEGVPSSRNYSGGFTSKLMAKDLDLAMASASG
VGFKCPMGSEALEIYRKLCEDGCELKDFSCAFRHHYAGKDEE*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0051287NAD binding
GO:0004616phosphogluconate dehydrogenase (decarboxylating) activity
GO:0016491oxidoreductase activity
GO:00084423-hydroxyisobutyrate dehydrogenase activity
Vocabulary: Biological Process
TermDefinition
GO:0055114oxidation-reduction process