Sh_006H11_contig-1_p000050

Overview
NameSh_006H11_contig-1_p000050
Unique NameSh_006H11_contig-1_p000050
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length771
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_006H11_contig-1contigSh_006H11_contig-1:21566..23936
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
InterProIPR002885
InterProIPR011990
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_006H11_contig-1_t000050Sh_006H11_contig-1_t000050R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_006H11_contig-1_p000050 ID=Sh_006H11_contig-1_p000050|Name=Sh_006H11_contig-1_p000050|organism=R570 Sugarcane cultivar|type=polypeptide|length=771bp
MRATVRTRRPRPPRPSPEVAKAPISPTTRSKPEKDLSPLTLPIRAFKLRL
ANGPPLAPTAKAFKSYSETCASLLRHCRATRAASTATSAYAPSSGFLPLV
LSLHAHTLRSGLAADRSVASNLLTAYAAFARAADRDQAFRDCVAADAASS
FTYDFMVSEHVKAGDIASARRLFDRMPEKSIVSYTTMVDALMKRGSVRDA
VVLYERCPLYSVAFFTAMIAGFARNELHKDAFLVFRKMLSCSVRPNVVTL
ICVIKACVGAGEFDLAMGVVGLAIKCNLFEKSIEVQNSLITLYLRMGDAA
AAHRVFDDMEVRDVVSWTALLDVYADLGDLEGARRVLDAMPERNEVSWGT
LIARNEQKGDPSEALRLYSQMLADGCRPNISCFSSVLSACATLQDLRGGT
RIHANVLKCKQCTDAQRVFNSLPEKNTVCWNSLISGYSWNGKMVEAEDLF
KKMPARNSASWNTMISGYAGNRRFGDALNYFCAMLASGQIPGEITLSSVL
LACANLCSLEMGKMVHAEIVKLGIEDNIFMGTALSDMYAKSGDLYSSRRM
FYQMPGKNNITWTAMVQGLAENGFAEESILLFEDMIANGIAPNEHTFLAI
LFACSHCGLVEQAIHYFETMQAHGIPPKDKHYTCMVDVLARAGRLPEAEE
LLMKVPSKSDTSSWSSLLSACNTYRNKEIGERAAKKLHELEKDNTAGYVL
LSNMYASCGKWKDAAETRILMQGASLKKDGGCSWLQLRGQYHAFFSWKGK
HPLSLEIYEILDLLIWELTT*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding