Sh_006H11_contig-1_p000100

Overview
NameSh_006H11_contig-1_p000100
Unique NameSh_006H11_contig-1_p000100
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length277
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_006H11_contig-1contigSh_006H11_contig-1:36229..38962
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_006H11_contig-1_t000100Sh_006H11_contig-1_t000100R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_006H11_contig-1_p000100 ID=Sh_006H11_contig-1_p000100|Name=Sh_006H11_contig-1_p000100|organism=R570 Sugarcane cultivar|type=polypeptide|length=277bp
MTLASAAHKIPLEVAHTLVEIAEVARYAYHHRPGHPADHDGDPTPLPAGA
DGGGGASEEAARLREENAMLRARLADDLALLRELHGAPCVSKECPPDLYN
RLMAAVNNASFLAHLEKLQDESAREHNELSSGNMTEVEVADIPDKMGNGK
KGSWVLVACDTAGANLEEISGIDDENYVIINEDDIVDGIATFVARCILED
PKSKSLSPVQLQKAVAKALDSMKARWRWSTFWEAGQIIYILATWGITLAG
LYKSRHVLKVAAKGAAASARFVMKAL*
back to top