Sh_006H11_contig-1_p000110

Overview
NameSh_006H11_contig-1_p000110
Unique NameSh_006H11_contig-1_p000110
Typepolypeptide
OrganismR570 Sugarcane cultivar (R570 (sugarcane cultivar))
Sequence length634
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
Sh_006H11_contig-1contigSh_006H11_contig-1:40413..44671
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Structural and functional annotation of S. officinarum2017-07-25
Cross References
External references for this polypeptide
DatabaseAccession
EC2.7.13.3
InterProIPR029016
InterProIPR003018
InterProIPR003594
InterProIPR003661
InterProIPR005467
InterProIPR004358
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesType
Sh_006H11_contig-1_t000110Sh_006H11_contig-1_t000110R570 Sugarcane cultivarmRNA


Sequences
The following sequences are available for this feature:

polypeptide sequence

>Sh_006H11_contig-1_p000110 ID=Sh_006H11_contig-1_p000110|Name=Sh_006H11_contig-1_p000110|organism=R570 Sugarcane cultivar|type=polypeptide|length=634bp
MDGCDCIEPLWPTDDLLVKYQYISDFFIALAYFSIPLELIYFVKKSSFFP
YRWVLIQFGAFIVLCGATHLINLWTFTTHTKTVAMVMTIAKVSTAVVSCA
TALMLVHIIPDLLSVKTRELFLKNKAEELDREMGLIRTQEETGRHVRMLT
HEIRSTLDRHTILKTTLVELGRTLGLEECALWMPSRSGSSLQLSHTLRHQ
ITVGSVPINLPVVNQVFSSNRAIIIPHTSPLARIRPLAGRYVPPEVAAVR
VPLLHLSNFQINDWPELSAKSFAIMVLMLPSDSARKWHVHELELVEVVAD
QVAVALSHAAILEESMRARDLLMEQNVALDLARREAEMAIRARNDFLAVM
NHEMRTPMNAIIALSSLLLETELTPEQRLMVETVLKSSNLLATLINDVLD
LSKLEDGSLELEIKAFNLHAVFKEAMSFIKPIASIKRLSVSVMLAPDLPL
CAIGDEKRLMQTILNISGNAVKFTKEGHITLVASIVKADSLREFRTPEFH
PTASDDHFYLKVQVKDTGCGIGPQDLPHVFTKFAHPQSGGNRGFNGSGLG
LAICKRFVSLMGGHIWIDSEGTGRGCTATFIVKLGVCDNTNTYQQQLIPL
VWPNSADSDLSAPKVLPDGRGSTSLKSRYQRSV*
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Molecular Function
TermDefinition
GO:0005515protein binding
GO:0000155phosphorelay sensor kinase activity
GO:0016772transferase activity, transferring phosphorus-containing groups
Vocabulary: Biological Process
TermDefinition
GO:0007165signal transduction
GO:0016310phosphorylation